Basic Information | |
---|---|
IMG/M Taxon OID | 3300026544 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296292 | Ga0256827 |
Sample Name | Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV84 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 741067616 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Pacific Ocean: East Pacific Rise | |||||||
Coordinates | Lat. (o) | 9.8441 | Long. (o) | -104.2969 | Alt. (m) | N/A | Depth (m) | 2511 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029285 | Metagenome / Metatranscriptome | 189 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0256827_10003200 | Not Available | 10430 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0256827_10003200 | Ga0256827_1000320012 | F029285 | MKNMADYSLYECPFSHIEKECGHELHGPEGYQNTYSVWCPCGFKGPVFVLNVDDLKLKLI |
⦗Top⦘ |