NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026389

3300026389: Metatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.12 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300026389 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132855 | Gp0291465 | Ga0247507
Sample NameMetatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.12 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size55921905
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0381
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa
TypeEngineered
TaxonomyEngineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: New York
CoordinatesLat. (o)42.4447Long. (o)-76.485Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022683Metagenome / Metatranscriptome213N
F031111Metagenome / Metatranscriptome183N
F080090Metagenome / Metatranscriptome115Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247507_100959All Organisms → cellular organisms → Bacteria6969Open in IMG/M
Ga0247507_109085All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii1299Open in IMG/M
Ga0247507_122263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038594Open in IMG/M
Ga0247507_127063Not Available503Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247507_100959Ga0247507_1009595F031111MNNQVFFSIFKNKTRRKKEKSRFLIGKKRCISYIPQNSYYQTIVNIPAAYNFSCYYPQNLPSSQIGKQVKEISKPLNLALIKLFKPKLTFP
Ga0247507_109085Ga0247507_1090851F080090YWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0247507_122263Ga0247507_1222631F022683PLTDFYAKWSKDSLDMMSKGMAMYNRMSRAWTEVGEGSAAEKPEDMLKKWTEAFSGSYNELFEMYAQPFKMFGMGGQTPGKEAWEEAFAKWQKMFTAMPSGPAPAAGDEFMNFSKNWFEGYSKIWQTWMESMQRMGEACKSAVSEGEKPDAAMGAFTEISDRFMQQWSAFVTEQAQAFFTLWRSRLPSEKKEPAKKAK
Ga0247507_127063Ga0247507_1270631F080090MYWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.