x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300026303
3300026303: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_2/2/2009_ DNA (SPAdes)
Overview
Basic Information
IMG/M Taxon OID 3300026303 Open in IMG/M GOLD Reference Gs0055735 | Gp0103136 | Ga0209793 Sample Name Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_2/2/2009_ DNA (SPAdes) Sequencing Status Permanent Draft Sequencing Center DOE Joint Genome Institute (JGI) Published? Y Use Policy Open
Dataset Contents
Total Genome Size 276078593 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales 1 All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa Type Engineered Taxonomy Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
Location Information
Location Madison, Wisconsin, USA Coordinates Lat. (o ) 43.076217 Long. (o ) -89.411742 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F020726 Metagenome / Metatranscriptome 222 Y F088774 Metagenome / Metatranscriptome 109 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0209793_1051623 All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales 906 Open in IMG/M Ga0209793_1078121 All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae 656 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0209793_1051623 Ga0209793_10516232 F088774 VGSSVQADAKFLRRVFLGLVFLTLVTGAMAGLTTVQAMSDKSGACVFFCQ Ga0209793_1078121 Ga0209793_10781212 F020726 LQGRLFRLAALSLTFVGFSSVVVTLQGRLGGELSDRHLRLVRLYIEGGFLVTALALVPTLLTFVQVPDRFVWPLSSAAAGAIFTLVLLIQFRRRRQVEPGRFPAWVIVIYVLSVA
