NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026302

3300026302: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_5/23/2013_ DNA (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026302 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055735 | Gp0103142 | Ga0209794
Sample NameWastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_5/23/2013_ DNA (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size264821411
Sequencing Scaffolds2
Novel Protein Genes4
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMadison, Wisconsin, USA
CoordinatesLat. (o)43.076217Long. (o)-89.411742Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007648Metagenome347Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209794_1001823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae13583Open in IMG/M
Ga0209794_1009487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2996Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209794_1001823Ga0209794_100182319F007648MTIQHTPEQEIWVMTTEGANITGYNSRYLQQLAKKNAQLPDNERFIKVRMRSNRHELWLPDLLHYIDEIGYGPHQNKK
Ga0209794_1001823Ga0209794_10018237F007648MAREFTPDQEIWVMTAEAAQITGYNRQYIEKLSKKNWLLPEDERLFKLRRRSGHYYEIWLPDLLRYIDETGYGPHKNK
Ga0209794_1001823Ga0209794_10018238F007648MAREITPDQEIWVMTKEAAEITGYNHEYMEILGKKNFRLPENERLIKIRKRSGRFYELWLPDLLRYIDEIGYGPHKNK
Ga0209794_1009487Ga0209794_10094874F007648MAVEITPEQEIWVMTTEGSEITGYNRQYLEKLAYKNWRLPENERVIKVRFRARRYEVWLPDLLRYIDEIGYGPHQNKQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.