x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300026287
3300026287: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/10/2011_ DNA (SPAdes)
Overview
Basic Information
IMG/M Taxon OID 3300026287 Open in IMG/M GOLD Reference Gs0055735 | Gp0103139 | Ga0209571 Sample Name Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/10/2011_ DNA (SPAdes) Sequencing Status Permanent Draft Sequencing Center DOE Joint Genome Institute (JGI) Published? Y Use Policy Open
Dataset Contents
Total Genome Size 202013532 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae 1 All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa Type Engineered Taxonomy Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
Location Information
Location Madison, Wisconsin, USA Coordinates Lat. (o ) 43.076217 Long. (o ) -89.411742 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F030790 Metagenome / Metatranscriptome 184 Y F097376 Metagenome / Metatranscriptome 104 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0209571_1010958 All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae 1843 Open in IMG/M Ga0209571_1023933 All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria 1085 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0209571_1010958 Ga0209571_10109581 F030790 MRRALQYSTAVVATLAVLAIGQEARAAPLTLTQVPGGTVGPQSASLPCVIAATQCQQPAGMGFNNFTSSGAISSYNMYSTTPTANVADGVQGTPYTVAQIAGALGSLAFNIAIDVNTTAAAGETLQLFEVIVNGIVAYNFVGPTVIGGASSNGNGYADWTLSTVDLSSFAAGASVLFHAVWNHASDGGESFFLVPTSGTTIPEPRSLLIFGAGLLGLAALGQLYRRRRVEV Ga0209571_1023933 Ga0209571_10239332 F097376 MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLTELKKVSGGLPRGGWEKIK
