NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026287

3300026287: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/10/2011_ DNA (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026287 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055735 | Gp0103139 | Ga0209571
Sample NameWastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/10/2011_ DNA (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size202013532
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMadison, Wisconsin, USA
CoordinatesLat. (o)43.076217Long. (o)-89.411742Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030790Metagenome / Metatranscriptome184Y
F097376Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209571_1010958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1843Open in IMG/M
Ga0209571_1023933All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1085Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209571_1010958Ga0209571_10109581F030790MRRALQYSTAVVATLAVLAIGQEARAAPLTLTQVPGGTVGPQSASLPCVIAATQCQQPAGMGFNNFTSSGAISSYNMYSTTPTANVADGVQGTPYTVAQIAGALGSLAFNIAIDVNTTAAAGETLQLFEVIVNGIVAYNFVGPTVIGGASSNGNGYADWTLSTVDLSSFAAGASVLFHAVWNHASDGGESFFLVPTSGTTIPEPRSLLIFGAGLLGLAALGQLYRRRRVEV
Ga0209571_1023933Ga0209571_10239332F097376MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLTELKKVSGGLPRGGWEKIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.