NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026247

3300026247: Upper troposphere microbial communities - SEAC4RS-RF6-003 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026247 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110167 | Gp0085223 | Ga0209133
Sample NameUpper troposphere microbial communities - SEAC4RS-RF6-003 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20243295
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium ADurb.Bin3311
Not Available3
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationUSA and various oceans
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007965Metagenome / Metatranscriptome341Y
F050360Metagenome / Metatranscriptome145Y
F051872Metagenome / Metatranscriptome143N
F054846Metagenome / Metatranscriptome139N
F058997Metagenome / Metatranscriptome134N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209133_100691All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium ADurb.Bin331682Open in IMG/M
Ga0209133_101150Not Available583Open in IMG/M
Ga0209133_101161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
Ga0209133_101693Not Available521Open in IMG/M
Ga0209133_101793Not Available514Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209133_100691Ga0209133_1006913F058997ERIMIIYKDQQMTVREAFKLMGIDCDDFMAWCKKFALQNYGYALNYYKRTLKFKKG
Ga0209133_101150Ga0209133_1011502F054846SRESRKSLSEHDTARKPERVPMYAQRTMIDTTLIPEGYNGHWVSNNPAGRIDMLLRAGYDFVTKDQNVYSSHVTENGVDSRVSKSGSDGVTLYLMIIPLELYEADQEAKAEKAKEQTATIFGKQRNDPDFFSRDENGRDTPASRGIGRVTTNDFVL
Ga0209133_101161Ga0209133_1011612F007965MKKKKETRGGKRSFSGRKKSPYETKTIAFRVRVEFIEPIKKMVKDYVSERLQGDA
Ga0209133_101693Ga0209133_1016931F050360TEQVVHNNMLREIEGMSYGGDVQDDVSDWTDVNTYLPEFSRMVWAACPNAVLCYHQTFLLYMDSDCQWRDNRGYLFSGKVNFWQYADVPECNVSC
Ga0209133_101793Ga0209133_1017931F051872DFDAIDALLAERDKLMKAEPVAKQEEPLAIDDTNDDGETQEQLQAAAQKWIADNPWYNKLTQAGRDQAAKLEAEYRAKVDCTTEEALAYVAQEMGKDPIVEVLKGKLKSPDVTPRTAERPRVASASESSLDPASRNIYNKMISQGLLKTAAEKNAFIKDALGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.