| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026233 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110167 | Gp0085191 | Ga0209762 |
| Sample Name | Upper troposphere microbial communities from Maryland, USA - DAQMD-021 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 49300789 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter → Hypericibacter terrae | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
| Type | Environmental |
| Taxonomy | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland, Virginia | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021533 | Metagenome / Metatranscriptome | 218 | Y |
| F024268 | Metagenome / Metatranscriptome | 206 | Y |
| F091607 | Metagenome / Metatranscriptome | 107 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209762_101860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter → Hypericibacter terrae | 1471 | Open in IMG/M |
| Ga0209762_106789 | Not Available | 650 | Open in IMG/M |
| Ga0209762_109983 | Not Available | 506 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209762_101860 | Ga0209762_1018601 | F024268 | MITEFFANSEAVGSTEWSLTTDTAGPDVEVTKGCFQIFLDISDMIAGDELEIKIYEKVQSSDTQRVIYQSNLIGPQSPAVWVSPSLILLNGWDVTLKTIAGGTITVSWSIRKAG |
| Ga0209762_106789 | Ga0209762_1067891 | F091607 | MSLETQISELNATIKTLNENILLLLGSKEQHSKVECSPVEPANLGQTEQQTFLPEVAKSDEYTREQLQSLCLEATKRNAANRDIIKAIMLSNFEARKTGDLADNQINLCY |
| Ga0209762_109983 | Ga0209762_1099832 | F021533 | MKTIAATVINEVVTPIEPMPSDASLIVFNGTEYVIYEDGDELPVIE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |