NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026042

3300026042: Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026042 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111376 | Gp0116107 | Ga0208538
Sample NameNatural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size38900910
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameNatural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomewetland areasoil
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Fairfield, San Francisco Bay, California
CoordinatesLat. (o)38.209766Long. (o)-122.033424Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007558Metagenome / Metatranscriptome349Y
F014394Metagenome / Metatranscriptome263Y
F024001Metagenome / Metatranscriptome208Y
F034114Metagenome / Metatranscriptome175Y
F073725Metagenome / Metatranscriptome120N
F081923Metagenome / Metatranscriptome114N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208538_1000020Not Available3056Open in IMG/M
Ga0208538_1002358All Organisms → cellular organisms → Bacteria860Open in IMG/M
Ga0208538_1003239All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria778Open in IMG/M
Ga0208538_1003651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria751Open in IMG/M
Ga0208538_1007167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria605Open in IMG/M
Ga0208538_1011454All Organisms → cellular organisms → Bacteria518Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208538_1000020Ga0208538_10000204F034114VPVIMRETSVAAGAVNENLLAGSAFEFARQNSLVSIGINQSATGGFATINSGADVVAEEFAPPINTVYPIIPDGMYFSDVAAAGDRLVIRYRNPTGGALTVRVVCQVTPL
Ga0208538_1002358Ga0208538_10023582F073725MEKRATRRYRISTSIVCSYLNSVDFGKPVDGRMRNCCVNGLYAELGTHYKAGTVLVVRTTGSSCGYSNEKGFRLLAVAEVKWSRPRSIEGGACYATGLKYLML
Ga0208538_1003239Ga0208538_10032391F014394MRAGSRFLATLFAAVVWIYAGMSVASRPVAQEAITPSVLDVAASCAAAVMD
Ga0208538_1003651Ga0208538_10036511F007558MQTIAEIKMLLLEILESAFQSGDVNATQQMGVNMTNAVKREGVVIIQNQNVEVYARIMPLMVKTLKLCDAVESSWRGQATIELEPQQKQLPPPADDDDPDPIEACCSWLYDNHIQWQDMQDLMKARYLAYVIGRFKTKTEAAKWLGVGSTYLCKLSKTTLHAVSQN
Ga0208538_1007167Ga0208538_10071671F081923MKRLIVNISSAIRPVMHRKHFFVMAILGAALAVACTMANTGSIQTSAEVTRQFEGLQVNPNYRYWYLNQENNPFGVIGLDREYGFAGGPVWRAVESDSPIFRKVVGLVESFPVASSLTTGYTIFEQQGRPIGVWYSSIGLGVTIDPATKTVSPATTTPWKSPF
Ga0208538_1011454Ga0208538_10114541F024001AKGSRKNKLAILGVEAPGRQGAKTQEYLDIPSFCNAAGRDALASKMLSYF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.