NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025775

3300025775: Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC2 2012 metaG (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025775 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111485 | Gp0115599 | Ga0209276
Sample NameHot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC2 2012 metaG (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size179603298
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → Geobacter soli1
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springsediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationCanada: British Columbia
CoordinatesLat. (o)49.9543Long. (o)-116.5155Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024282Metagenome / Metatranscriptome206Y
F087401Metagenome / Metatranscriptome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209276_101567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → Geobacter soli14086Open in IMG/M
Ga0209276_138762All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria528Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209276_101567Ga0209276_1015671F087401MRRQRGLVGLMGLAALVGWGVNARLAEARVTTEQSASILVFPKVLATASRDTVIQITNTSNNMRHAHCFYVDGSPVNPDLPVGPLNPPRWVETDFDIWLTRQQPTHWVVSTGRWDDPTDDSCRGAVCNPANSGGNNGTADCCDAGFDPGRIPPMGPNFTGELKCVEVDASGFPVPGNSLKGEATLVDRGNAFDVSKYNGIGLKGFDTNNMDGVLCLGGGVTGSCPSGAEYEACPQAWILDTPSVNAANPVLSTAELDSSAAV
Ga0209276_138762Ga0209276_1387622F024282LLEDEVVELARTVGRALVEHYGVRPEWGGMNYTVHELIEQEEATGTREVVLKHLTTAEDRRAAEAAMREMHRLLEAYAEGLARRHLGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.