NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025738

3300025738: Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM9C Gulf of Mexico (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025738 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118071 | Gp0127830 | Ga0209292
Sample NameMethane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM9C Gulf of Mexico (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size758807392
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa2
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMethane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine cold seep biomemesocosmsediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationGulf of Mexico
CoordinatesLat. (o)27.37Long. (o)-90.57Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006552Metagenome370Y
F061265Metagenome / Metatranscriptome132Y
F066858Metagenome / Metatranscriptome126N
F101886Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209292_1010423All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria8179Open in IMG/M
Ga0209292_1047970All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa2529Open in IMG/M
Ga0209292_1098264All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1416Open in IMG/M
Ga0209292_1273613All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote584Open in IMG/M
Ga0209292_1294101Not Available545Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209292_1010423Ga0209292_10104232F101886MLKKIVIIGFCLFNVALFIQIGIEVAAVTPEQAMLEGMTQRIYASISTLDYIMAALWGAILYTILTAKKEHFLRASYLYLGFYLCDIHFSHYMSIEMNDPYFTPGALALVVIQAGFLFWAKTRIHAVSSSLSN
Ga0209292_1047970Ga0209292_10479702F101886MLKKSAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAALWGAILYTILAAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLVVIQVWFLYWAKNKINAANAAVSN
Ga0209292_1098264Ga0209292_10982642F101886MLKKSAIIGFCLFNVVLFILIGIEVAAVTPERAMSEGVTQRIYASISTLDYIMAALWGAILYTILTAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLVVIQAWFLYWAKNKINAANAAVPS
Ga0209292_1273613Ga0209292_12736131F006552LNDTKNNGMAPIDLRYLDLGKKVLIVXENAMNQYPTVWEATPNVEIPLLISPVLKIKSSRINPVANIPKPIPIAKKAIDNLNNVGLAVFLNPIYEIVPITRPTKSPTRLRIISKKNSNYADSVTVLNKVXEQVF
Ga0209292_1294101Ga0209292_12941011F061265LVCCGAIQKKEYFMSLDWDLIWKIFQVVALLIIAREIDKRIRKRKK
Ga0209292_1296460Ga0209292_12964601F066858SIFLFRKMYDADAKRTSANKILKISGERSEDMNAPSTVPGTAINPSFQPSESSMRFCLAYTAVDATELLNTANKLLLTASVGENPTNVNTGTIIIPPPRPIIEPNRPATNPSGMSQILSINVLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.