NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025731

3300025731: Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM8C Gulf of Mexico (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025731 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118071 | Gp0127834 | Ga0209396
Sample NameMethane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM8C Gulf of Mexico (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size698776050
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Pseudomaricurvus → Pseudomaricurvus alkylphenolicus1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMethane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine cold seep biomemesocosmsediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationGulf of Mexico
CoordinatesLat. (o)27.37Long. (o)-90.57Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101886Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209396_1005484All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria11959Open in IMG/M
Ga0209396_1019311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4975Open in IMG/M
Ga0209396_1020386All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4772Open in IMG/M
Ga0209396_1061250All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Pseudomaricurvus → Pseudomaricurvus alkylphenolicus1944Open in IMG/M
Ga0209396_1069487All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1747Open in IMG/M
Ga0209396_1291124All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa511Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209396_1005484Ga0209396_10054849F101886MLKKILIIGFCLFNVAFFIQIGIEVAAVTPEQAMLEGMTQRIYASISTLDYIMAALWGAILYSILTAKKEHFLRASYLYLGFYLCDIHFSHYMSIEMN
Ga0209396_1019311Ga0209396_10193112F101886MLKKSAIIGFCLFNVVLFILIGIEVAAVTPERAMSEGVTQRIYASISTLDYIMAALWWAILYTILTAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLVVIQAWFLYWAKNKINAANAAVSN
Ga0209396_1020386Ga0209396_10203864F101886MLKKIVIIGFCLFNVALFIQIGIEVAAVTPEQAMLEGMTQRIYASISTLDYIMAALWGAILYTILTAKKEHFLRASYLYLGFYLCDIHFSHYMSIEMNDPYFTPGALALVAIQAGFLFWAKTRIHAVSFSLSN
Ga0209396_1061250Ga0209396_10612503F101886MLKKFAVIGFCLFNVVLFILIGIEVAAVTPERAMSEGVTQRIYASISTLDYIMAALWGAILYTILTAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLVVIQAWFLYWAKNKINAANAAVPS
Ga0209396_1069487Ga0209396_10694871F101886MLKKSAIIGFCLFNVVLFILIGIEVAAVTPERAMSEGVTQRIYASISTLDYIMAALWGAILYTILTAKTEHFLRVSWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALFLVVIQAWFLYWAKTRIDAANVAVSN
Ga0209396_1291124Ga0209396_12911241F101886MLKKSAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAALWGAILYTILAAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLVVIQVWFL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.