| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025304 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053073 | Gp0101304 | Ga0209257 |
| Sample Name | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 461935468 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Loktanella → unclassified Loktanella → Loktanella sp. PT4BL | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 35.6667 | Long. (o) | -78.5097 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013935 | Metagenome / Metatranscriptome | 267 | Y |
| F044595 | Metagenome | 154 | Y |
| F069485 | Metagenome / Metatranscriptome | 124 | Y |
| F073010 | Metagenome / Metatranscriptome | 120 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209257_1027956 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1865 | Open in IMG/M |
| Ga0209257_1095344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 735 | Open in IMG/M |
| Ga0209257_1118329 | Not Available | 623 | Open in IMG/M |
| Ga0209257_1132385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Loktanella → unclassified Loktanella → Loktanella sp. PT4BL | 569 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209257_1027956 | Ga0209257_10279562 | F044595 | LESVIVKSAYVVTANRPMNGLVAFVRAAAMKSIGGCASALHPSLPTSYQRLDRNEDQVHPGEGSA |
| Ga0209257_1095344 | Ga0209257_10953441 | F013935 | IVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA |
| Ga0209257_1118329 | Ga0209257_11183291 | F069485 | MASGPCVPHQQAAHMAAPTRLKHRIKKTLAKGEPSTHDPKRAL |
| Ga0209257_1132385 | Ga0209257_11323851 | F073010 | PRVLAVLACATFACILLYQLPWSPAASAHFTARTGQLPFDERPAGYTLSGALRDFQRLGPEGLQDYRAYRVLDLLFPWLLCALVAGVMLRLEAERATMWPWLAALADSAENVALWAMFLTRDDLSPRLVPVASFLTQLKFCLYAAMLLMLLAVGVRYVLRERRRARMAG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |