| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025198 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054065 | Ga0208059 |
| Sample Name | Marine microbial communities from the Deep Indian Ocean - MP0959 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 80141733 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | East of Madagascar, South Indian Ocean | |||||||
| Coordinates | Lat. (o) | -27.98 | Long. (o) | 63.25 | Alt. (m) | N/A | Depth (m) | 3504.69 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002753 | Metagenome / Metatranscriptome | 532 | Y |
| F064726 | Metagenome / Metatranscriptome | 128 | Y |
| F094378 | Metagenome / Metatranscriptome | 106 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208059_1005259 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1577 | Open in IMG/M |
| Ga0208059_1018713 | Not Available | 757 | Open in IMG/M |
| Ga0208059_1037578 | All Organisms → cellular organisms → Eukaryota | 501 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208059_1005259 | Ga0208059_10052592 | F064726 | QKDSTATANNKRKFRSPNRVLARSFRLARDKWKQKYMELRANLKSARQLATERGTSRDLWRAEYDAANQRAIQAEALAQQRLDKLEQLRSEHQELKKKRI |
| Ga0208059_1018713 | Ga0208059_10187131 | F094378 | NHLGNFQAKGPYIITLERRLSLTEGVNLSGNKTEGVY |
| Ga0208059_1037578 | Ga0208059_10375781 | F002753 | VNNTVSDRFTPAVFEIESVNNTVSDRFTPAVFETESVKLTDSDRFTPAVFETESVKLTDSDKFTPAVFETESVNDIDSVRFTPDVFEIESVNDTDSDRFTGAVFEIESVKLTVSDRFTPAVFDIESVNNTVSDRFTPAVFEIESVKLTVSDRFTPAVFEIESVKLT |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |