NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025088

3300025088: Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D2 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025088 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053054 | Gp0055714 | Ga0208246
Sample NameSoil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D2 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size314404630
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Rifle, Colorado, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → land → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationRifle, Colorado, United States
CoordinatesLat. (o)39.534762Long. (o)-107.782602Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056711Metagenome / Metatranscriptome137Y
F069483Metagenome / Metatranscriptome124Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208246_1006254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4556Open in IMG/M
Ga0208246_1014724All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2588Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208246_1006254Ga0208246_10062544F069483VRLAFESPGDRDGKRVARPERIRTASEIPIEVDLTDEDTIPIYMRISDKVLHLRRLGMTYTNIARPLGINPWMAKKAARWGNIQKG
Ga0208246_1014724Ga0208246_10147241F056711MRKAFTALAAAAFALSIVAGGCAKDKSPSQLQAGKKGIAGTEKKAAPKPRAKLFTGTIEDLDEAAGTLTLKGPKGEMSFQARKKVKEQLGELEIGDKVIVKHDG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.