Basic Information | |
---|---|
IMG/M Taxon OID | 3300025023 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0067852 | Gp0056770 | Ga0207877 |
Sample Name | Marine viral communities from the Pacific Ocean - LP-29 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 44194404 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 48.9698 | Long. (o) | -130.6666 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001536 | Metagenome | 675 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0207877_13016 | Not Available | 507 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0207877_13016 | Ga0207877_130161 | F001536 | WIKSLIEKVLGKFCKCEEPVILEDEEYLAEEKALADHAESFKEITEPEKIQCNTHSRFKKSCPVCVEAAK |
⦗Top⦘ |