


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300024983 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118793 | Gp0095075 | Ga0207420 |
| Sample Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 225773098 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
| Type | Engineered |
| Taxonomy | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Africa: Cape Town | |||||||
| Coordinates | Lat. (o) | -33.936637 | Long. (o) | 18.478905 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002483 | Metagenome / Metatranscriptome | 555 | Y |
| F007832 | Metagenome / Metatranscriptome | 344 | Y |
| F021102 | Metagenome / Metatranscriptome | 220 | Y |
| F099558 | Metagenome / Metatranscriptome | 103 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0207420_1000358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia | 51700 | Open in IMG/M |
| Ga0207420_1011744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 2917 | Open in IMG/M |
| Ga0207420_1029474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1221 | Open in IMG/M |
| Ga0207420_1040480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 844 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0207420_1000358 | Ga0207420_100035830 | F099558 | MTPSNTQLRTSFVPSIARRDRSVVSRLLSAILSQWPERTRGSPRLPNYLRRDIGLDPVDEGRRYWDHQ |
| Ga0207420_1011744 | Ga0207420_10117442 | F007832 | VPFLADIFPGGGGPLADVFSIVIAIAMFAVLYWLISLIDRI |
| Ga0207420_1029474 | Ga0207420_10294741 | F002483 | PARRRPPAYFLVAGIRLDQEMDRLRGLPAFAGGPLEKRPELKVRRASTRPNRVGFAVPTEHRLQVTSYPGIRPGDVLETLLHELVHLHVGRAREAHAWHGRTFKATLAQAMDEAYGVVGVPTRSTLHGAYAEAIERQRAQPQLELDLA |
| Ga0207420_1040480 | Ga0207420_10404802 | F021102 | MRRESPVKRRNPSGKVVWVARYRGRDGRHHIAKPTWNKGKGTFDRKADAQRAIDEAYGVSDRPDTLGDYFSTWTERHPRSERTNATNEHRIGRLVDVEVEGIALKDWPLRELRRRHALVLVDHMLKTEGRATTGAVGILRSLSAMAEDAITDEVCDLNPFKGVRIRASDPRAQKRRRPIRVFSFEEMHRFAKGAGCNEP |
| ⦗Top⦘ |