


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300024979 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114290 | Gp0111068 | Ga0208115 |
| Sample Name | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 4_LOW4 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 146542960 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1 |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Lake Washington, Seattle, Washington | |||||||
| Coordinates | Lat. (o) | 48.3807 | Long. (o) | -122.1599 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031715 | Metagenome / Metatranscriptome | 182 | Y |
| F063813 | Metagenome / Metatranscriptome | 129 | N |
| F070270 | Metagenome | 123 | Y |
| F087391 | Metagenome / Metatranscriptome | 110 | N |
| F090575 | Metagenome | 108 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208115_1024223 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| Ga0208115_1028700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1064 | Open in IMG/M |
| Ga0208115_1035385 | Not Available | 911 | Open in IMG/M |
| Ga0208115_1067792 | Not Available | 553 | Open in IMG/M |
| Ga0208115_1074650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 512 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208115_1024223 | Ga0208115_10242231 | F063813 | INDFLTNEEVLPIIQKDALMSLVQWSQAHGQKLKPTELESNAQSLAKPSPSSKKPSHQFGSRTGSTPIDETKSIERGLS |
| Ga0208115_1028700 | Ga0208115_10287002 | F031715 | DPSLASIRNDPEFKAVFADIERDMARQRAELAAKPQDAPLDLGSVH |
| Ga0208115_1035385 | Ga0208115_10353852 | F087391 | MKLTKFALLAVAAGCTLASQGVYAQAMEVVTVEAVREIVIGKSPIGAPIKELTIRARVSYADLDLTTATGAATLEKRVRDSATSSCKEIKVDVPVEGWTVDRCIREATEGAMVQVNKAVADA |
| Ga0208115_1067792 | Ga0208115_10677922 | F090575 | FPTSEAYLAGIDAWTRSVLDASVAAPDGKGWIQDNRALPEILLGIEHLFGAGSAASLIVQAVLLHQSLNVVPEWPNPGSLTEAELPLCISPALLPLLEAMMLVDSDAWQLFDPASKAKFRQGTLAVFANVRRLLGG |
| Ga0208115_1074650 | Ga0208115_10746501 | F070270 | GIPIATAKKFGPIVIDYVGHHGGEDLVDKIKEALGL |
| ⦗Top⦘ |