NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300024972

3300024972: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 10_HOW4 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300024972 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111072 | Ga0208626
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 10_HOW4 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size136652456
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034190Metagenome / Metatranscriptome175Y
F093898Metagenome / Metatranscriptome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208626_1015258All Organisms → cellular organisms → Bacteria → Proteobacteria1444Open in IMG/M
Ga0208626_1032165Not Available858Open in IMG/M
Ga0208626_1032372Not Available854Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208626_1015258Ga0208626_10152582F093898MMRFLLARAVNPQLSLLDGLRDWNAIAAGLREPPRRRRRYQGDNLERFLS
Ga0208626_1032165Ga0208626_10321651F034190FTGDSAAFPHIWAVLQHLIDTRGAFLNGDWPFINAVLGLMSPSATHPCPICIVSHNNYLHFSRHRTPADRHSLHPDQCPLLTIPPERIVPTPLHLFLGISNRIILDAYKELFGEAVVATSVAAVKTVHSAGCGGLSDLYDLNGPEISKFIKQIDPEKGGSPLKAAAAAPTASAEQKASHSILSRWLQQLHHCLLRSDDWTAVDIDGWRSVVDDIWQHWCAEAHSEPFPKLHMLRHSLEFAERHRFLGRASEAQIESFHASFNTLFHKHHLNQGGNTDERLRRSLAD
Ga0208626_1032372Ga0208626_10323721F034190RHSLHPDQCPLLTIPPERIVPTPLHLFLGISNRIILDAFSELLGRERVEAALKAVTTVHSAGCGGKSDLYDLNGPEIRKFIKRKCSVSILAAAAASSSLPPSTTASHSILSRWLQQLHTHLLHKDDWESEEIEEWRAAVDDIWQNWRAETKQAAFPKLHMLKHSLEFAERHRFLGRASEAQIESFHASFNTLFHKQHLNQGGNTDERMRRCLADAALRAVQPFLSVSPSTPSTSF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.