NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300024970

3300024970: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 20_HOW5 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300024970 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114290 | Gp0111078 | Ga0207967
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 20_HOW5 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size91696917
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biome → freshwater lake → lake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034190Metagenome / Metatranscriptome175Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207967_1013876Not Available1018Open in IMG/M
Ga0207967_1023095Not Available722Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207967_1013876Ga0207967_10138761F034190GLMSPSATHPCPICIVSHNNYLHSSRHRTPADRHSLHPDQCPLLTIPPERIVPTPLHLFLGISNRILLDAYKELFGEAVVATSVAAVKTVHSAGCGGLSDLYDLNGPEISKFIKQIDPEKGNSPLKAAAAAPTASAEQKASHSILSRWLQQLHHCLLRSEDWTAVDIDGWRSVVDDIWQHWCAEAHSEPFPKLHMLRHSLEFAERHRFLGRASEAQIESFHASFNTLFHKHHLNQGDNTDERLRRSLADATLRAVQPFLSTSPSTPSTSF
Ga0207967_1023095Ga0207967_10230951F034190GRERVEAALKAVTTVHSAGCGGKSDLYDLNGPEIRKFIKRKCSVSILAAAAASSSLPPSTTASHSILSRWLQQLHTHLLHKDDWESEEIEEWRAAVDDIWQNWRAETKQAAFPKLHMLKHSLEFAERHRFLGRASEAQIESFHASFNTLFHKQHLNQGGNTDERMRRCLADAALRAVQPFLSVSPSTPSTSF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.