| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300023507 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118692 | Gp0139191 | Ga0257019 |
| Sample Name | Marine microbial mat from Loihi Seamout, Hawaii, USA - Marker 31 Individual Assembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Western Washington University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 259766108 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Mats From Loihi Seamount, Hawaii, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Loihi Seamount, Hawaii, USA | |||||||
| Coordinates | Lat. (o) | 18.902 | Long. (o) | -155.257 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039145 | Metagenome / Metatranscriptome | 164 | Y |
| F059103 | Metagenome / Metatranscriptome | 134 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0257019_1006466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 5769 | Open in IMG/M |
| Ga0257019_1067062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1055 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0257019_1006466 | Ga0257019_10064663 | F039145 | MRGFLTSLLVSMVLLAGCGQQPVNAPAELGAFIDELKENGVDGTLLVRPPFNADMEYVAEYEIARYASTRVVSLFKFVDSEKAQVNLQEALKNDKLSGQARNGAFVMAVTFYPPDDGAVEKIKALFLAHKFE |
| Ga0257019_1067062 | Ga0257019_10670622 | F059103 | MSSSEGCDFVLRLGPLDAATAAWSLDFCGHLQQGIWRAYGDEIEAHWAATEPDQPIYGPLSPTPPSKKR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |