Basic Information | |
---|---|
IMG/M Taxon OID | 3300023507 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118692 | Gp0139191 | Ga0257019 |
Sample Name | Marine microbial mat from Loihi Seamout, Hawaii, USA - Marker 31 Individual Assembly |
Sequencing Status | Permanent Draft |
Sequencing Center | Western Washington University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 259766108 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Mats From Loihi Seamount, Hawaii, Usa |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → microbial mat material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Loihi Seamount, Hawaii, USA | |||||||
Coordinates | Lat. (o) | 18.902 | Long. (o) | -155.257 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039145 | Metagenome / Metatranscriptome | 164 | Y |
F059103 | Metagenome / Metatranscriptome | 134 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0257019_1006466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 5769 | Open in IMG/M |
Ga0257019_1067062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1055 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0257019_1006466 | Ga0257019_10064663 | F039145 | MRGFLTSLLVSMVLLAGCGQQPVNAPAELGAFIDELKENGVDGTLLVRPPFNADMEYVAEYEIARYASTRVVSLFKFVDSEKAQVNLQEALKNDKLSGQARNGAFVMAVTFYPPDDGAVEKIKALFLAHKFE |
Ga0257019_1067062 | Ga0257019_10670622 | F059103 | MSSSEGCDFVLRLGPLDAATAAWSLDFCGHLQQGIWRAYGDEIEAHWAATEPDQPIYGPLSPTPPSKKR |
⦗Top⦘ |