Basic Information | |
---|---|
IMG/M Taxon OID | 3300022807 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120440 | Gp0149062 | Ga0242719 |
Sample Name | Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R15 Version 2 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of New South Wales |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 104471290 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Sponge Microbes In A High Co2 World |
Type | Host-Associated |
Taxonomy | Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Davies Reef, Great Barrier Reef, Australia | |||||||
Coordinates | Lat. (o) | -18.833 | Long. (o) | 147.683 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028464 | Metagenome / Metatranscriptome | 191 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0242719_165354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 752 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0242719_165354 | Ga0242719_1653542 | F028464 | VGLGTDRRHPDFRHVDGSVMNARLYIDDRLIVHEQGMLDRSLLHHPEVLEAASAYGDPYQVLAPVSHDAHGSGTLW |
⦗Top⦘ |