| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300022750 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290982 | Ga0247812 |
| Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L149-409B-1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 750494808 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1 |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049431 | Metagenome / Metatranscriptome | 146 | N |
| F051903 | Metagenome / Metatranscriptome | 143 | Y |
| F061214 | Metagenome / Metatranscriptome | 132 | Y |
| F088701 | Metagenome / Metatranscriptome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0247812_10052235 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima | 1898 | Open in IMG/M |
| Ga0247812_10147178 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 946 | Open in IMG/M |
| Ga0247812_10147524 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 944 | Open in IMG/M |
| Ga0247812_10295460 | Not Available | 590 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0247812_10052235 | Ga0247812_100522351 | F049431 | MTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK |
| Ga0247812_10147178 | Ga0247812_101471781 | F051903 | MCEEIATVRRKFQRIGTRRILVLDETHRRIGDVTERTIVLPGEPSTIETSATTHYAPRYDMIACCTSKEVMPPMIYAPKERGKGIDTEMLLQYIRNLLAQSAGALDRYPLFLMLDKSTIHNEGKIIETFHDWGCQELVEVIKMPTAAAKRLSPLDNSLFNVWRQRALNGPPLTRTNIKQRMSDAWNSITERDLLPQYRHCGLMRHQDVYFDCPNPATHRHGS |
| Ga0247812_10147524 | Ga0247812_101475241 | F061214 | VISALCRLVNGFAKLTNINLALKVNPDQWRPYNEGPKVAEYLGR |
| Ga0247812_10295460 | Ga0247812_102954601 | F088701 | VALNKPEKIPIPVFKKKKYKLSYVIKVEITKIEIVALEYNIDLSRLSVIEFDNSSIINDNVNI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |