NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022750

3300022750: Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L149-409B-1



Overview

Basic Information
IMG/M Taxon OID3300022750 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0290982 | Ga0247812
Sample NamePlant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L149-409B-1
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size750494808
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldplant litter
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049431Metagenome / Metatranscriptome146N
F051903Metagenome / Metatranscriptome143Y
F061214Metagenome / Metatranscriptome132Y
F088701Metagenome / Metatranscriptome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247812_10052235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1898Open in IMG/M
Ga0247812_10147178All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria946Open in IMG/M
Ga0247812_10147524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata944Open in IMG/M
Ga0247812_10295460Not Available590Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247812_10052235Ga0247812_100522351F049431MTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0247812_10147178Ga0247812_101471781F051903MCEEIATVRRKFQRIGTRRILVLDETHRRIGDVTERTIVLPGEPSTIETSATTHYAPRYDMIACCTSKEVMPPMIYAPKERGKGIDTEMLLQYIRNLLAQSAGALDRYPLFLMLDKSTIHNEGKIIETFHDWGCQELVEVIKMPTAAAKRLSPLDNSLFNVWRQRALNGPPLTRTNIKQRMSDAWNSITERDLLPQYRHCGLMRHQDVYFDCPNPATHRHGS
Ga0247812_10147524Ga0247812_101475241F061214VISALCRLVNGFAKLTNINLALKVNPDQWRPYNEGPKVAEYLGR
Ga0247812_10295460Ga0247812_102954601F088701VALNKPEKIPIPVFKKKKYKLSYVIKVEITKIEIVALEYNIDLSRLSVIEFDNSSIINDNVNI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.