NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022655

3300022655: Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_4 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300022655 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0132838 | Gp0267153 | Ga0232060
Sample NameMetatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_4 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size107287631
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAnaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass → Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: California
CoordinatesLat. (o)37.8719Long. (o)-122.2585Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001819Metagenome / Metatranscriptome630Y
F029377Metagenome / Metatranscriptome188Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0232060_1021188All Organisms → cellular organisms → Bacteria665Open in IMG/M
Ga0232060_1079370All Organisms → cellular organisms → Bacteria695Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0232060_1021188Ga0232060_10211882F029377MKDRTHSLPSFAAWLNKGFDLRNHAAEMRDARVAPEISPGSVFLALFHAFIFRLPSFQQLDHELSHSHLQHWVGAERSFHD
Ga0232060_1079370Ga0232060_10793702F001819QRDGHRTKGKTAAPQESTNFYATNFELGSISPLFIHQFSRSRWRIDTEVFQTITTGCHLKHPSVHQTTALVVLTMIRLLAYTLSVVFYHRQVLSHARGKCETFHECAKRIDYGFATLAADTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.