NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022365

3300022365: Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.186 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300022365 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114516 | Gp0225706 | Ga0210322
Sample NameMetatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.186 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22451694
Sequencing Scaffolds6
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Nitzschia → Nitzschia inconspicua1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEstuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Alternative Ecosystem Assignments
Environment Ontology (ENVO)estuarine biome → estuary → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Washington
CoordinatesLat. (o)46.313Long. (o)-123.997Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008361Metagenome / Metatranscriptome334Y
F030134Metagenome / Metatranscriptome186Y
F037756Metagenome / Metatranscriptome167Y
F038776Metagenome / Metatranscriptome165Y
F042051Metagenome / Metatranscriptome159Y
F047147Metagenome / Metatranscriptome150Y
F075465Metagenome / Metatranscriptome119Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0210322_100373All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Nitzschia → Nitzschia inconspicua2121Open in IMG/M
Ga0210322_102608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage982Open in IMG/M
Ga0210322_103793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
Ga0210322_105390Not Available722Open in IMG/M
Ga0210322_108082Not Available605Open in IMG/M
Ga0210322_108383Not Available597Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0210322_100373Ga0210322_1003731F008361EATKDLEKATLAVEMAETSKSRLDASVELKKATARVEAINYLS
Ga0210322_102608Ga0210322_1026082F042051MTTVFGEVSWNDDVYPGGGGGNKNSKDLFMRLDEGSNEMRLVTQPFQYLVHKYKKEGDSGWGQKVSCSAIHGSCPLCASGDKPKPRWLLGVISRKTNTYKILDISYAVFSQIRKLARNTQRWGDPTKYDIDIVVDKQGGPTGYYSVQPISKEPLSASDQQIKDTVDFDDLKRRVSPLTPENVQKRIDKINGVETGGK
Ga0210322_103793Ga0210322_1037931F038776VHSVYMGDMMSKFEINYSELETAIVKKAYRLEDVKDRIERVAFDVVRFKDDDEGANLWQIQSADDGDYIVAIYQQEPEEKVASDWSVQVSKVASALLVSYKGDPIVRIAAANIGIPPTELPQAEKYLPKKLAENKKLVKALLNELEESAKKEVLNKYPELV
Ga0210322_105390Ga0210322_1053901F037756ALFPVPTFGAHLAAAAGFPTPFSAANGVSGLVAGPSNLLQG
Ga0210322_108082Ga0210322_1080821F047147QPLSVIIVAVTEGLVREEQLLHDMCLLSATTVDITQTLTRAGQSF
Ga0210322_108383Ga0210322_1083831F030134PSVLKYLKIKAKDKIQPVSQRFKLRSCTVLIVEQTNPLSTYNQGGTIIQHRGSNHVFR
Ga0210322_110693Ga0210322_1106931F075465KTQYSNESRTYRERVSKLETHRGQVYSLILGQCTQLLHDKLKQAAKWTKVSTSYNPLTLFRLIEKTVLAQTEDQYPFATVYDQEHALYSFRQELMTNAQWYEKFNTRVDVGEAIGVTRQHKVLLEFVAQETHNQAFTALGAVEQAAVRDDAEERYRSYVFLKQSGGQHGHLKQTLQNDF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.