NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022052

3300022052: Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 (v2)



Overview

Basic Information
IMG/M Taxon OID3300022052 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127565 | Gp0198101 | Ga0224903
Sample NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 (v2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1588165
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomeocean straitsea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064635Metagenome128N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0224903_10019Not Available551Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0224903_10019Ga0224903_100191F064635FESTQSKVLWTKKEREVARRTKAERQAVLSDEKKASPPKNKPITDIFASVVKSKNGSEYCQVVFTVKDEFFPKKMPLMFGHPTAHNMAVRKWKKITTKWGSPSQPWMAAELINSGAFDTISEIIVQKQGKYENVVGIKTKQNEDIDL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.