| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300021261 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0131209 | Gp0238793 | Ga0213896 |
| Sample Name | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Cave_2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 10838498 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → land → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: West Virginia | |||||||
| Coordinates | Lat. (o) | 39.458 | Long. (o) | -79.073 | Alt. (m) | N/A | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017849 | Metagenome | 238 | Y |
| F083339 | Metagenome / Metatranscriptome | 113 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0213896_100489 | Not Available | 641 | Open in IMG/M |
| Ga0213896_100519 | Not Available | 632 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0213896_100489 | Ga0213896_1004892 | F017849 | MVEGAKSWLRDNSTLIYFLIAQFIAIGAFAASGIAYMVKLETRVAIMETRGAEYTVARMEEMKLKIAGLEHQIEKNEKSIDRIVDVMTKKLNISP |
| Ga0213896_100519 | Ga0213896_1005191 | F083339 | ISLPSDFATMASIRDATSGEMLRLKDAWSGHWVGRQSSAWQEGAVVGAVGQVCTSYRLTGDCIEFLPHPILPDPPDPAWVPQVVIMEWYAKPKPLLLPSDTNPVLEQLYAVYLWGVLKHGALFELDDDRAAQADAQWQQVVTRANLWKQQSDYSGAPLRSELVSFG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |