NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300021055

3300021055: Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos C3



Overview

Basic Information
IMG/M Taxon OID3300021055 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118431 | Gp0224410 | Ga0206226
Sample NameSubsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos C3
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size96621018
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2
Not Available1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSubsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → planetary subsurface zone → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: Colorado
CoordinatesLat. (o)38.96Long. (o)-106.99Alt. (m)N/ADepth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001506Metagenome / Metatranscriptome681Y
F002347Metagenome / Metatranscriptome568Y
F022276Metagenome / Metatranscriptome215Y
F025377Metagenome202Y
F096759Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0206226_1000505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3530Open in IMG/M
Ga0206226_1001616All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira1452Open in IMG/M
Ga0206226_1003352All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1000Open in IMG/M
Ga0206226_1005552Not Available806Open in IMG/M
Ga0206226_1008408All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta687Open in IMG/M
Ga0206226_1014526All Organisms → cellular organisms → Bacteria566Open in IMG/M
Ga0206226_1019425All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0206226_1000505Ga0206226_10005055F001506MNQILYKNRCRCNEEFSLSKKRKSVSRSEGKPIQYPKSNEILSKTFQIKYEKKLSLIAKLVLNSFQNKYIYYAIDDILYLFELNKNERENLLAILYSPILSLQNNYSVNFFDIWIKEIYIDEIFKSNKFLLTDSQTSKQFSYITIRLFYKTKVPLKKQESLW
Ga0206226_1001616Ga0206226_10016161F022276MGGVLALALAIGIVFGAHKLCDLIGAPLWFAKYLFICASLITAYFFAEEVVPNKPLAVWLAMLGAATGIIPVGFIVFKHIEDSDNREVRDSSE
Ga0206226_1003352Ga0206226_10033521F001506YENRCKCNEEFSITKKRKSTNRSEGKALQYPKHSEITSKIFQIEYHEHLSLTAKFILNSFHNKYIYYAIDDILYSLRSNPSERDNLLAVLYSPILSLQNDFLVNFFDIWIRDISLNEISKSNKFLKQEAENLEKVNLITIKLFYKTRVPIKKQESLW
Ga0206226_1005552Ga0206226_10055522F096759NTPGQLVFGRDMILNIKHEANWEYIRSRKQKIIEKNNKAENRKRIPHEYTVGDKVLLKRGNENKYEAPYQGPYTILKINENGTVRMKVNDVEDTYNIRRLTPYIGPDDIVHGGECSMRTSRVKRRRQE
Ga0206226_1008408Ga0206226_10084082F001506TKKKLESKKKKGKPRGPNPLVYPDLNESTFTTFQIKYEKKLSSIAKFILNSFQKKYFYYAIDDILYLLKSNPIEQNNLLTILYSPVLSLHNNLCVNFFDIWIDQVYIDERSKVNKFLNRDFQNLEEFTYITITLWYVIRIPIKEKEPLW
Ga0206226_1014526Ga0206226_10145261F025377MNVYGKWILQSVPCFGLGLLMLLSTVTPRQARSNVEAWFLYFGIENIPPWLADEYTDTWVFWIGSVGFCLWATQLYFRQNLRIGKLSVIIRDGEPWVQVDSHIDRSQAAPTSGRLYTYRLALINSADVTFRNVEVKLTSLE
Ga0206226_1019425Ga0206226_10194251F002347VISMSQLDKQQILRQIAAIPAMERGKLSAYSLEERTGMTGPYFKLQRWENGKNHTRHVPCEERPAVETALAGYAHYQELTTQYADLVIAETRQDLADAKKKRLRRRTFSPRRRNSNT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.