NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300020818

3300020818: Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2



Overview

Basic Information
IMG/M Taxon OID3300020818 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0130338 | Gp0242119 | Ga0214277
Sample NameFood waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Toronto
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1044915087
Sequencing Scaffolds441
Novel Protein Genes486
Associated Families68

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available77
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum113
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae49
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis31
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu25
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum8
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 13
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays14
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae8
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata16
All Organisms → cellular organisms → Eukaryota → Opisthokonta18
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare5
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei10
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae3
All Organisms → cellular organisms → Eukaryota2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-7826
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Stipodae → Brachypodieae → Brachypodium → Brachypodium distachyon1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis2
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Odontophorus → Odontophorus gujanensis1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. FS411
All Organisms → Viruses → Riboviria → Pararnavirae → Artverviricota → Revtraviricetes → Ortervirales → Retroviridae → Orthoretrovirinae → Gammaretrovirus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus4
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactiplantibacillus → Lactiplantibacillus plantarum1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f51
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Capra → Capra hircus1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Coetzeevirus → Lactobacillus virus phiJL11
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tybeckvirinae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Companilactobacillus1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lacticaseibacillus → Lacticaseibacillus paracasei1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes From Anaerobic Digester Of Solid Waste
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001445Metagenome692Y
F001813Metagenome630Y
F002002Metagenome / Metatranscriptome605Y
F002471Metagenome / Metatranscriptome556Y
F002994Metagenome / Metatranscriptome514Y
F003406Metagenome / Metatranscriptome488Y
F004001Metagenome457Y
F004815Metagenome422Y
F005658Metagenome393Y
F006329Metagenome / Metatranscriptome376Y
F007409Metagenome / Metatranscriptome351Y
F009131Metagenome / Metatranscriptome322Y
F010678Metagenome / Metatranscriptome300Y
F011632Metagenome288Y
F012765Metagenome / Metatranscriptome277Y
F013050Metagenome / Metatranscriptome275Y
F014346Metagenome / Metatranscriptome263Y
F014592Metagenome / Metatranscriptome261Y
F015450Metagenome / Metatranscriptome254N
F017089Metagenome242Y
F018877Metagenome / Metatranscriptome232Y
F020289Metagenome224Y
F020492Metagenome223Y
F020828Metagenome / Metatranscriptome221Y
F027342Metagenome195Y
F028669Metagenome190Y
F029075Metagenome / Metatranscriptome189Y
F032472Metagenome / Metatranscriptome180Y
F033854Metagenome176Y
F034384Metagenome175Y
F035108Metagenome173Y
F035626Metagenome / Metatranscriptome171Y
F037171Metagenome / Metatranscriptome168N
F038003Metagenome / Metatranscriptome167Y
F038012Metagenome166Y
F038084Metagenome / Metatranscriptome166Y
F038489Metagenome165Y
F039656Metagenome / Metatranscriptome163Y
F046965Metagenome / Metatranscriptome150Y
F048299Metagenome / Metatranscriptome148Y
F050219Metagenome / Metatranscriptome145Y
F052316Metagenome142Y
F053764Metagenome / Metatranscriptome140Y
F057793Metagenome135Y
F059631Metagenome133Y
F062313Metagenome130Y
F065281Metagenome127Y
F067310Metagenome / Metatranscriptome125Y
F068298Metagenome124Y
F071823Metagenome121Y
F076748Metagenome117Y
F076912Metagenome117Y
F079404Metagenome115Y
F081962Metagenome113Y
F083289Metagenome113Y
F086390Metagenome110Y
F089079Metagenome109Y
F091813Metagenome107Y
F092835Metagenome / Metatranscriptome107Y
F093003Metagenome106Y
F094706Metagenome105Y
F096317Metagenome104Y
F096850Metagenome / Metatranscriptome104N
F098130Metagenome / Metatranscriptome104Y
F099086Metagenome / Metatranscriptome103N
F103019Metagenome / Metatranscriptome101Y
F104139Metagenome100Y
F105149Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0214277_10007255Not Available508Open in IMG/M
Ga0214277_10010118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum589Open in IMG/M
Ga0214277_10034891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae841Open in IMG/M
Ga0214277_10035049All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis821Open in IMG/M
Ga0214277_10035407Not Available1360Open in IMG/M
Ga0214277_10041661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu1217Open in IMG/M
Ga0214277_10041744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum730Open in IMG/M
Ga0214277_10044178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu729Open in IMG/M
Ga0214277_10046956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum527Open in IMG/M
Ga0214277_10047039Not Available1441Open in IMG/M
Ga0214277_10049505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1712Open in IMG/M
Ga0214277_10049652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum674Open in IMG/M
Ga0214277_10049878Not Available719Open in IMG/M
Ga0214277_10055749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum506Open in IMG/M
Ga0214277_10056578Not Available697Open in IMG/M
Ga0214277_10058153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum545Open in IMG/M
Ga0214277_10058335All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum794Open in IMG/M
Ga0214277_10059627All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 11011Open in IMG/M
Ga0214277_10062345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays674Open in IMG/M
Ga0214277_10066021All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae647Open in IMG/M
Ga0214277_10069264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata801Open in IMG/M
Ga0214277_10069756All Organisms → cellular organisms → Eukaryota → Opisthokonta706Open in IMG/M
Ga0214277_10072876All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare724Open in IMG/M
Ga0214277_10075407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu608Open in IMG/M
Ga0214277_10078553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae504Open in IMG/M
Ga0214277_10085681All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis570Open in IMG/M
Ga0214277_10090160All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens596Open in IMG/M
Ga0214277_10093216All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei985Open in IMG/M
Ga0214277_10095912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae554Open in IMG/M
Ga0214277_10106516Not Available508Open in IMG/M
Ga0214277_10106967All Organisms → cellular organisms → Eukaryota → Opisthokonta528Open in IMG/M
Ga0214277_10109814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum611Open in IMG/M
Ga0214277_10120366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare574Open in IMG/M
Ga0214277_10122857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum589Open in IMG/M
Ga0214277_10130817Not Available1053Open in IMG/M
Ga0214277_10131415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae570Open in IMG/M
Ga0214277_10136606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata578Open in IMG/M
Ga0214277_10147742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare512Open in IMG/M
Ga0214277_10150696All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis637Open in IMG/M
Ga0214277_10152811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum754Open in IMG/M
Ga0214277_10160947All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae812Open in IMG/M
Ga0214277_10161471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum745Open in IMG/M
Ga0214277_10162419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum508Open in IMG/M
Ga0214277_10168501All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1061Open in IMG/M
Ga0214277_10173036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum767Open in IMG/M
Ga0214277_10176113All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae635Open in IMG/M
Ga0214277_10179217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu501Open in IMG/M
Ga0214277_10184883Not Available902Open in IMG/M
Ga0214277_10187464All Organisms → cellular organisms → Eukaryota768Open in IMG/M
Ga0214277_10187773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum595Open in IMG/M
Ga0214277_10188375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum511Open in IMG/M
Ga0214277_10195324All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum682Open in IMG/M
Ga0214277_10195435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum613Open in IMG/M
Ga0214277_10200436Not Available728Open in IMG/M
Ga0214277_10203723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum671Open in IMG/M
Ga0214277_10208370All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78913Open in IMG/M
Ga0214277_10213380All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei566Open in IMG/M
Ga0214277_10217809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum651Open in IMG/M
Ga0214277_10222299Not Available573Open in IMG/M
Ga0214277_10223220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum850Open in IMG/M
Ga0214277_10232918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays906Open in IMG/M
Ga0214277_10239888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum629Open in IMG/M
Ga0214277_10241225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae852Open in IMG/M
Ga0214277_10242590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays682Open in IMG/M
Ga0214277_10245252All Organisms → cellular organisms → Eukaryota → Opisthokonta776Open in IMG/M
Ga0214277_10250331All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78567Open in IMG/M
Ga0214277_10250528Not Available926Open in IMG/M
Ga0214277_10251906Not Available2494Open in IMG/M
Ga0214277_10252817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Stipodae → Brachypodieae → Brachypodium → Brachypodium distachyon515Open in IMG/M
Ga0214277_10255952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum714Open in IMG/M
Ga0214277_10263018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu678Open in IMG/M
Ga0214277_10265417Not Available515Open in IMG/M
Ga0214277_10265603All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata538Open in IMG/M
Ga0214277_10268508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum588Open in IMG/M
Ga0214277_10276746All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78586Open in IMG/M
Ga0214277_10278568Not Available559Open in IMG/M
Ga0214277_10282818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum605Open in IMG/M
Ga0214277_10283846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1037Open in IMG/M
Ga0214277_10290750All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78636Open in IMG/M
Ga0214277_10296414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu501Open in IMG/M
Ga0214277_10296443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum668Open in IMG/M
Ga0214277_10296748All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis808Open in IMG/M
Ga0214277_10302660All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78617Open in IMG/M
Ga0214277_10304072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum763Open in IMG/M
Ga0214277_10304173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays680Open in IMG/M
Ga0214277_10307458All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78709Open in IMG/M
Ga0214277_10310422All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78625Open in IMG/M
Ga0214277_10311824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum547Open in IMG/M
Ga0214277_10314772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1117Open in IMG/M
Ga0214277_10318596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae680Open in IMG/M
Ga0214277_10329339Not Available529Open in IMG/M
Ga0214277_10335246Not Available1461Open in IMG/M
Ga0214277_10336637All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis507Open in IMG/M
Ga0214277_10336751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum640Open in IMG/M
Ga0214277_10340111Not Available513Open in IMG/M
Ga0214277_10343684Not Available815Open in IMG/M
Ga0214277_10348125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis655Open in IMG/M
Ga0214277_10351442Not Available1172Open in IMG/M
Ga0214277_10361770All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78506Open in IMG/M
Ga0214277_10364026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum522Open in IMG/M
Ga0214277_10364096All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae785Open in IMG/M
Ga0214277_10367002All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78577Open in IMG/M
Ga0214277_10370019All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78502Open in IMG/M
Ga0214277_10377228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1018Open in IMG/M
Ga0214277_10377571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae503Open in IMG/M
Ga0214277_10379394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum902Open in IMG/M
Ga0214277_10381891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum667Open in IMG/M
Ga0214277_10391526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae816Open in IMG/M
Ga0214277_10392964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae563Open in IMG/M
Ga0214277_10393731Not Available799Open in IMG/M
Ga0214277_10407506Not Available749Open in IMG/M
Ga0214277_10414853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei534Open in IMG/M
Ga0214277_10419420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata616Open in IMG/M
Ga0214277_10422175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum782Open in IMG/M
Ga0214277_10440820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum800Open in IMG/M
Ga0214277_10442025Not Available567Open in IMG/M
Ga0214277_10446483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum706Open in IMG/M
Ga0214277_10449944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1011Open in IMG/M
Ga0214277_10450547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium864Open in IMG/M
Ga0214277_10455281All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis783Open in IMG/M
Ga0214277_10455329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu664Open in IMG/M
Ga0214277_10460961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum687Open in IMG/M
Ga0214277_10465372All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei625Open in IMG/M
Ga0214277_10469452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae957Open in IMG/M
Ga0214277_10473475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae579Open in IMG/M
Ga0214277_10480139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis506Open in IMG/M
Ga0214277_10482231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum648Open in IMG/M
Ga0214277_10483387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae892Open in IMG/M
Ga0214277_10484026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum694Open in IMG/M
Ga0214277_10485170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae711Open in IMG/M
Ga0214277_10485188Not Available533Open in IMG/M
Ga0214277_10485471All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae1232Open in IMG/M
Ga0214277_10495704All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae641Open in IMG/M
Ga0214277_10496210All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum802Open in IMG/M
Ga0214277_10497710Not Available615Open in IMG/M
Ga0214277_10502578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1344Open in IMG/M
Ga0214277_10505907Not Available533Open in IMG/M
Ga0214277_10506523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu854Open in IMG/M
Ga0214277_10507461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu662Open in IMG/M
Ga0214277_10510930Not Available633Open in IMG/M
Ga0214277_10513542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum523Open in IMG/M
Ga0214277_10519376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu627Open in IMG/M
Ga0214277_10528110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu696Open in IMG/M
Ga0214277_10529872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum625Open in IMG/M
Ga0214277_10538683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum968Open in IMG/M
Ga0214277_10540673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis740Open in IMG/M
Ga0214277_10541125All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea794Open in IMG/M
Ga0214277_10549710All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78595Open in IMG/M
Ga0214277_10550328All Organisms → cellular organisms → Eukaryota → Opisthokonta531Open in IMG/M
Ga0214277_10560034Not Available504Open in IMG/M
Ga0214277_10560122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu529Open in IMG/M
Ga0214277_10562367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1517Open in IMG/M
Ga0214277_10564801Not Available1480Open in IMG/M
Ga0214277_10565811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum769Open in IMG/M
Ga0214277_10575025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum706Open in IMG/M
Ga0214277_10579492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis592Open in IMG/M
Ga0214277_10581911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae731Open in IMG/M
Ga0214277_10582009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae557Open in IMG/M
Ga0214277_10583872All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78994Open in IMG/M
Ga0214277_10587498All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves795Open in IMG/M
Ga0214277_10589868Not Available752Open in IMG/M
Ga0214277_10592226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum879Open in IMG/M
Ga0214277_10597619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae677Open in IMG/M
Ga0214277_10603654All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae854Open in IMG/M
Ga0214277_10605408All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78650Open in IMG/M
Ga0214277_10610278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata533Open in IMG/M
Ga0214277_10618142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum869Open in IMG/M
Ga0214277_10619626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum678Open in IMG/M
Ga0214277_10624558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1173Open in IMG/M
Ga0214277_10626106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum527Open in IMG/M
Ga0214277_10629734All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78555Open in IMG/M
Ga0214277_10634847Not Available573Open in IMG/M
Ga0214277_10638705All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae576Open in IMG/M
Ga0214277_10639377All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae736Open in IMG/M
Ga0214277_10646093Not Available514Open in IMG/M
Ga0214277_10649317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu584Open in IMG/M
Ga0214277_10659111Not Available660Open in IMG/M
Ga0214277_10662905All Organisms → cellular organisms → Eukaryota → Opisthokonta2892Open in IMG/M
Ga0214277_10672931All Organisms → cellular organisms → Eukaryota → Opisthokonta581Open in IMG/M
Ga0214277_10674175All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78553Open in IMG/M
Ga0214277_10683378All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis560Open in IMG/M
Ga0214277_10695653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis518Open in IMG/M
Ga0214277_10697187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata515Open in IMG/M
Ga0214277_10698248All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu509Open in IMG/M
Ga0214277_10709901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu629Open in IMG/M
Ga0214277_10711313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae582Open in IMG/M
Ga0214277_10711686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum855Open in IMG/M
Ga0214277_10715813All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum910Open in IMG/M
Ga0214277_10718678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii919Open in IMG/M
Ga0214277_10729445Not Available534Open in IMG/M
Ga0214277_10733794Not Available529Open in IMG/M
Ga0214277_10747987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae805Open in IMG/M
Ga0214277_10756725All Organisms → cellular organisms → Eukaryota → Opisthokonta656Open in IMG/M
Ga0214277_10760468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata516Open in IMG/M
Ga0214277_10763366All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei732Open in IMG/M
Ga0214277_10764048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu834Open in IMG/M
Ga0214277_10768157Not Available596Open in IMG/M
Ga0214277_10769741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae636Open in IMG/M
Ga0214277_10770686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum568Open in IMG/M
Ga0214277_10772465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum956Open in IMG/M
Ga0214277_10779978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum673Open in IMG/M
Ga0214277_10781260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum605Open in IMG/M
Ga0214277_10781569Not Available523Open in IMG/M
Ga0214277_10783322All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii829Open in IMG/M
Ga0214277_10791428All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Odontophoridae → Odontophorus → Odontophorus gujanensis651Open in IMG/M
Ga0214277_10796126All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78635Open in IMG/M
Ga0214277_10800847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum670Open in IMG/M
Ga0214277_10801767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. FS41554Open in IMG/M
Ga0214277_10803542Not Available572Open in IMG/M
Ga0214277_10806647All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum677Open in IMG/M
Ga0214277_10810597All Organisms → Viruses → Riboviria → Pararnavirae → Artverviricota → Revtraviricetes → Ortervirales → Retroviridae → Orthoretrovirinae → Gammaretrovirus2740Open in IMG/M
Ga0214277_10810880All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae538Open in IMG/M
Ga0214277_10814753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae573Open in IMG/M
Ga0214277_10816855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum681Open in IMG/M
Ga0214277_10820124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1159Open in IMG/M
Ga0214277_10824901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae525Open in IMG/M
Ga0214277_10832458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu635Open in IMG/M
Ga0214277_10833914All Organisms → cellular organisms → Eukaryota → Opisthokonta579Open in IMG/M
Ga0214277_10835106Not Available816Open in IMG/M
Ga0214277_10836935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum921Open in IMG/M
Ga0214277_10841797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae607Open in IMG/M
Ga0214277_10847610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae586Open in IMG/M
Ga0214277_10848376Not Available704Open in IMG/M
Ga0214277_10850237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum543Open in IMG/M
Ga0214277_10858334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum741Open in IMG/M
Ga0214277_10870742All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei636Open in IMG/M
Ga0214277_10877318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays899Open in IMG/M
Ga0214277_10878628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum557Open in IMG/M
Ga0214277_10879985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1359Open in IMG/M
Ga0214277_10882681All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum763Open in IMG/M
Ga0214277_10889060All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78607Open in IMG/M
Ga0214277_10889327Not Available1101Open in IMG/M
Ga0214277_10890629All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus989Open in IMG/M
Ga0214277_10890643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum541Open in IMG/M
Ga0214277_10893714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum533Open in IMG/M
Ga0214277_10894476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1273Open in IMG/M
Ga0214277_10898512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis1023Open in IMG/M
Ga0214277_10900025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum1133Open in IMG/M
Ga0214277_10902186All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1819Open in IMG/M
Ga0214277_10906334All Organisms → cellular organisms → Eukaryota → Opisthokonta576Open in IMG/M
Ga0214277_10907061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum865Open in IMG/M
Ga0214277_10910089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum532Open in IMG/M
Ga0214277_10920095Not Available622Open in IMG/M
Ga0214277_10932665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum700Open in IMG/M
Ga0214277_10933330All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis683Open in IMG/M
Ga0214277_10936864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu781Open in IMG/M
Ga0214277_10942422All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78616Open in IMG/M
Ga0214277_10942885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum748Open in IMG/M
Ga0214277_10943178Not Available721Open in IMG/M
Ga0214277_10944435All Organisms → cellular organisms → Eukaryota538Open in IMG/M
Ga0214277_10945644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae663Open in IMG/M
Ga0214277_10951847Not Available641Open in IMG/M
Ga0214277_10952151All Organisms → cellular organisms → Eukaryota → Opisthokonta601Open in IMG/M
Ga0214277_10955642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae613Open in IMG/M
Ga0214277_10959902Not Available623Open in IMG/M
Ga0214277_10985024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1040Open in IMG/M
Ga0214277_10985255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactiplantibacillus → Lactiplantibacillus plantarum2170Open in IMG/M
Ga0214277_10985989All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78538Open in IMG/M
Ga0214277_10995402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae605Open in IMG/M
Ga0214277_10997969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora530Open in IMG/M
Ga0214277_10998645All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae670Open in IMG/M
Ga0214277_11005971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays618Open in IMG/M
Ga0214277_11006539All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus690Open in IMG/M
Ga0214277_11015933All Organisms → cellular organisms → Eukaryota → Opisthokonta521Open in IMG/M
Ga0214277_11021288Not Available577Open in IMG/M
Ga0214277_11022811All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78604Open in IMG/M
Ga0214277_11026564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei526Open in IMG/M
Ga0214277_11033237All Organisms → cellular organisms → Eukaryota → Opisthokonta777Open in IMG/M
Ga0214277_11039361All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis549Open in IMG/M
Ga0214277_11051201All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus505Open in IMG/M
Ga0214277_11051850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5509Open in IMG/M
Ga0214277_11055439Not Available681Open in IMG/M
Ga0214277_11055959All Organisms → cellular organisms → Eukaryota → Opisthokonta540Open in IMG/M
Ga0214277_11062394Not Available571Open in IMG/M
Ga0214277_11067257All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis516Open in IMG/M
Ga0214277_11070022Not Available699Open in IMG/M
Ga0214277_11073247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays575Open in IMG/M
Ga0214277_11078016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu843Open in IMG/M
Ga0214277_11086272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum682Open in IMG/M
Ga0214277_11099248Not Available555Open in IMG/M
Ga0214277_11100015Not Available655Open in IMG/M
Ga0214277_11105012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae759Open in IMG/M
Ga0214277_11105428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum508Open in IMG/M
Ga0214277_11107948Not Available569Open in IMG/M
Ga0214277_11111982All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum572Open in IMG/M
Ga0214277_11112415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1097Open in IMG/M
Ga0214277_11115761All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78645Open in IMG/M
Ga0214277_11116825All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1530Open in IMG/M
Ga0214277_11130072All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1204Open in IMG/M
Ga0214277_11132636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum869Open in IMG/M
Ga0214277_11135564All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare580Open in IMG/M
Ga0214277_11135818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays572Open in IMG/M
Ga0214277_11151930All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis556Open in IMG/M
Ga0214277_11153962All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei505Open in IMG/M
Ga0214277_11159037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae522Open in IMG/M
Ga0214277_11163493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum857Open in IMG/M
Ga0214277_11164832Not Available713Open in IMG/M
Ga0214277_11172261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae655Open in IMG/M
Ga0214277_11172296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea659Open in IMG/M
Ga0214277_11174136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae646Open in IMG/M
Ga0214277_11174293All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae710Open in IMG/M
Ga0214277_11174441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum782Open in IMG/M
Ga0214277_11179449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea505Open in IMG/M
Ga0214277_11187367All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Capra → Capra hircus549Open in IMG/M
Ga0214277_11189143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae586Open in IMG/M
Ga0214277_11194959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae691Open in IMG/M
Ga0214277_11205083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum994Open in IMG/M
Ga0214277_11206481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae642Open in IMG/M
Ga0214277_11229436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae537Open in IMG/M
Ga0214277_11229892All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis597Open in IMG/M
Ga0214277_11235513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu617Open in IMG/M
Ga0214277_11239240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata813Open in IMG/M
Ga0214277_11247178All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78574Open in IMG/M
Ga0214277_11248352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum533Open in IMG/M
Ga0214277_11256156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum572Open in IMG/M
Ga0214277_11256416All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum640Open in IMG/M
Ga0214277_11264866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78637Open in IMG/M
Ga0214277_11265047All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis539Open in IMG/M
Ga0214277_11268160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae640Open in IMG/M
Ga0214277_11270375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1235Open in IMG/M
Ga0214277_11271839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae529Open in IMG/M
Ga0214277_11272136Not Available500Open in IMG/M
Ga0214277_11272352All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis642Open in IMG/M
Ga0214277_11273241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays561Open in IMG/M
Ga0214277_11281567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays982Open in IMG/M
Ga0214277_11284987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum654Open in IMG/M
Ga0214277_11298366All Organisms → cellular organisms → Eukaryota → Opisthokonta546Open in IMG/M
Ga0214277_11304041All Organisms → cellular organisms → Eukaryota → Opisthokonta898Open in IMG/M
Ga0214277_11304167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata606Open in IMG/M
Ga0214277_11304299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Coetzeevirus → Lactobacillus virus phiJL1541Open in IMG/M
Ga0214277_11306087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu647Open in IMG/M
Ga0214277_11306809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum522Open in IMG/M
Ga0214277_11309474All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum649Open in IMG/M
Ga0214277_11317516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum567Open in IMG/M
Ga0214277_11321219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum542Open in IMG/M
Ga0214277_11335349All Organisms → cellular organisms → Eukaryota → Opisthokonta599Open in IMG/M
Ga0214277_11335902Not Available739Open in IMG/M
Ga0214277_11341214All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae507Open in IMG/M
Ga0214277_11343016All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1548Open in IMG/M
Ga0214277_11343639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum585Open in IMG/M
Ga0214277_11351385All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis795Open in IMG/M
Ga0214277_11354496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tybeckvirinae2306Open in IMG/M
Ga0214277_11366954All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis537Open in IMG/M
Ga0214277_11371975Not Available632Open in IMG/M
Ga0214277_11375799Not Available868Open in IMG/M
Ga0214277_11390081All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum889Open in IMG/M
Ga0214277_11392084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum581Open in IMG/M
Ga0214277_11396481Not Available1207Open in IMG/M
Ga0214277_11400176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum657Open in IMG/M
Ga0214277_11401050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae751Open in IMG/M
Ga0214277_11407391All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo575Open in IMG/M
Ga0214277_11417216Not Available583Open in IMG/M
Ga0214277_11417929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum718Open in IMG/M
Ga0214277_11418807Not Available580Open in IMG/M
Ga0214277_11421594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum575Open in IMG/M
Ga0214277_11422839Not Available531Open in IMG/M
Ga0214277_11430752All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus874Open in IMG/M
Ga0214277_11433921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum733Open in IMG/M
Ga0214277_11434111All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae522Open in IMG/M
Ga0214277_11446826Not Available532Open in IMG/M
Ga0214277_11451376All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus891Open in IMG/M
Ga0214277_11468392Not Available616Open in IMG/M
Ga0214277_11469373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays968Open in IMG/M
Ga0214277_11482778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae875Open in IMG/M
Ga0214277_11485456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1113Open in IMG/M
Ga0214277_11490736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Companilactobacillus622Open in IMG/M
Ga0214277_11492888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata793Open in IMG/M
Ga0214277_11493046All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum846Open in IMG/M
Ga0214277_11493738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum639Open in IMG/M
Ga0214277_11495401All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum788Open in IMG/M
Ga0214277_11496988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae741Open in IMG/M
Ga0214277_11498475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1373Open in IMG/M
Ga0214277_11510028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum605Open in IMG/M
Ga0214277_11510617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum898Open in IMG/M
Ga0214277_11510919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum693Open in IMG/M
Ga0214277_11519220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis920Open in IMG/M
Ga0214277_11521544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays504Open in IMG/M
Ga0214277_11523343All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu549Open in IMG/M
Ga0214277_11524656Not Available682Open in IMG/M
Ga0214277_11535596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata715Open in IMG/M
Ga0214277_11547211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum508Open in IMG/M
Ga0214277_11550236All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis631Open in IMG/M
Ga0214277_11556581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum553Open in IMG/M
Ga0214277_11557108Not Available608Open in IMG/M
Ga0214277_11558470All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei637Open in IMG/M
Ga0214277_11558546All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus967Open in IMG/M
Ga0214277_11564978Not Available657Open in IMG/M
Ga0214277_11565084Not Available517Open in IMG/M
Ga0214277_11565684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae777Open in IMG/M
Ga0214277_11568774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis745Open in IMG/M
Ga0214277_11578426All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis560Open in IMG/M
Ga0214277_11579368All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis627Open in IMG/M
Ga0214277_11579796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum590Open in IMG/M
Ga0214277_11580888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum1141Open in IMG/M
Ga0214277_11591952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum805Open in IMG/M
Ga0214277_11593316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum559Open in IMG/M
Ga0214277_11602348Not Available976Open in IMG/M
Ga0214277_11605788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lacticaseibacillus → Lacticaseibacillus paracasei604Open in IMG/M
Ga0214277_11610681All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae762Open in IMG/M
Ga0214277_11612152Not Available604Open in IMG/M
Ga0214277_11612973All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis657Open in IMG/M
Ga0214277_11617084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78557Open in IMG/M
Ga0214277_11617236All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78842Open in IMG/M
Ga0214277_11626528All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78632Open in IMG/M
Ga0214277_11626710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu601Open in IMG/M
Ga0214277_11628830Not Available504Open in IMG/M
Ga0214277_11642480All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata565Open in IMG/M
Ga0214277_11642748Not Available741Open in IMG/M
Ga0214277_11643456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum665Open in IMG/M
Ga0214277_11647700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum557Open in IMG/M
Ga0214277_11653998Not Available581Open in IMG/M
Ga0214277_11665550Not Available554Open in IMG/M
Ga0214277_11665854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum630Open in IMG/M
Ga0214277_11668400Not Available529Open in IMG/M
Ga0214277_11674149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis762Open in IMG/M
Ga0214277_11676965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare663Open in IMG/M
Ga0214277_11684598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae528Open in IMG/M
Ga0214277_11686536Not Available539Open in IMG/M
Ga0214277_11687561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae742Open in IMG/M
Ga0214277_11690087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum615Open in IMG/M
Ga0214277_11695498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum824Open in IMG/M
Ga0214277_11698736Not Available1046Open in IMG/M
Ga0214277_11703035All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae854Open in IMG/M
Ga0214277_11710802All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria535Open in IMG/M
Ga0214277_11712911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum512Open in IMG/M
Ga0214277_11715013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum507Open in IMG/M
Ga0214277_11715844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum557Open in IMG/M
Ga0214277_11724618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu606Open in IMG/M
Ga0214277_11724649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis666Open in IMG/M
Ga0214277_11724867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum733Open in IMG/M
Ga0214277_11730589All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu574Open in IMG/M
Ga0214277_11733684All Organisms → cellular organisms → Eukaryota → Opisthokonta659Open in IMG/M
Ga0214277_11739106Not Available521Open in IMG/M
Ga0214277_11742340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata564Open in IMG/M
Ga0214277_11746933All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis654Open in IMG/M
Ga0214277_11749028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae738Open in IMG/M
Ga0214277_11760516Not Available505Open in IMG/M
Ga0214277_11762095All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis679Open in IMG/M
Ga0214277_11764184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum788Open in IMG/M
Ga0214277_11765883All Organisms → cellular organisms → Eukaryota → Opisthokonta523Open in IMG/M
Ga0214277_11767012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum546Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0214277_10007255Ga0214277_100072553F001813QGTFGHCVEGHGLVRTIGDGWMVGLDDLVVLFHPW
Ga0214277_10010118Ga0214277_100101181F020828LSYFGLVRRLVDACPRLEVIKRSVCIEGARRAFARAKVHWGKLDAEKLVTEGPPEGKEHRRPEIYYEGVLKGARREVDECTRDVIFE
Ga0214277_10034891Ga0214277_100348911F094706MDPRLSPFTWTSDVIIPRELAPTVGLSHDGFKFLEGRFEGLEGYAVGLMTKSRRGKLYIDDVGWGPEAGSIEYGYRVPFGGIHVFIGKIVEPGPEPDICTDLVETAQRARSARVKPAVKRAFVGVIHGGSYEDGSESRGETVVYSGDESSTGETESLYQLQDGRIGGCSDSDSIPDPSDLPNRVGIFMAGTQAALHSSTAMPVTSGSVAATAARAGGSVRPPAQVLSDLFDALVVLMAEANPADQEVHNAEIAKVKE
Ga0214277_10035049Ga0214277_100350492F105149MYQGGSSAKKGPRIAIREQDVNLPRDANVRACEWPSDDFMGKAGFKEEFDAYVRNAELEDFLQDKCPQYYQLTDSFVQRFEYISARNSPSVIFDIYDTSYTMDLEDFTTACKLPQWGNINDPRKSEFRDFSC
Ga0214277_10035407Ga0214277_100354073F014346MLEESLESALDCKEVQXVHPKGDQSWAFIGRIDVE
Ga0214277_10041661Ga0214277_100416611F059631VRRRHGGQIANVTWLEGAFVETIKGWQSGWFYITKPRDPEWVAVPEFQSGIPTRLTSWKETGLLWGSPEEVTGLQTCVRDRVNKKVKLVNVVQVMLFRRILPCQRRAFRLWEFDPAQHQTLSWLFDTKHGDAWKVLFKSSKVSPPVTEDRGFCAE
Ga0214277_10041744Ga0214277_100417442F079404LTCASFSEGVNISSGRSRSVAYYRDRIPVRDPEEDVSEDWPSEWFYIEDVLLPDPILIGLPEFDNAPLKKRRSWRPRSPQEEDDRDVLYLMSRISFLARSGLTMIEVMAICIMRGVQPLQYRGHPMWDFNGEDDATRYGRKGTGSVADLIKILSTLYKGEEEEFLRVNPQGGFSMYNPPSWVSEDFFLPIRFVFP
Ga0214277_10044178Ga0214277_100441782F059631MLGKMPNVLWLERALVDSVKGWQSGWFYITEPREPTWAAAPEFRSGIPTQLTSWKEKGVLWGNPKELTGLRSCIQKLVSNKLRLVDVVQVMLIRRILPCQERAFNLWEFDPEQHQVLSGLFDTTYEGAWRVLFKGAEAPASATEDRGFCSQHPADEVSDSTPLRDTCDN
Ga0214277_10046956Ga0214277_100469562F083289NRNIALECEEGDAAYDEPVCAIEELKFYKHNVEPADMAPLKRPTTEHDPLLKFKSADDTKLVDFVPGDSSKQFSISANLDQK
Ga0214277_10047039Ga0214277_100470391F076912LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKIAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSESVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANQLAKLIASMVDTQDNVS
Ga0214277_10049505Ga0214277_100495051F035108MSAGMLTGRPAEEMPVSTGDQLPELLQLIERVRQAMSGVIQALWPAFSLPEGLGELAEKLQGVRQRFHLWKISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKFSQQDCKLDNLLDGIEEEYNQSI
Ga0214277_10049652Ga0214277_100496521F020828LVELHKAAEQAMKGFIVRMRPGDALPNSYFDLVRRLVDACPRLEVVKRSVCIEGARQAFARVKMQWAKLDAVKLIKEGPPEGKEHRHPEMYYEGVLKGARLVADECTKDIILE
Ga0214277_10049878Ga0214277_100498781F076912LGKSTLLSNGKGSNADKVQDSETSLLVSNKADKTAKENYLEESEAPPKSYLGLLLKLLATTTGASSSNLLSKLVRFLEPQLQAERYRSAVLRQEAKGLQKSQEHSDAYFLVQQQALEDFSAKQDKANQLAKLIASMVDTQDNVSXALQKLF
Ga0214277_10055749Ga0214277_100557491F052316MVKTRYPKADPNHMAEVGPVGPDGKEIPVSLMYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSV
Ga0214277_10056578Ga0214277_100565782F004001LRQAAQVESPSLEVFKNCVDVALRDMGKGHGGDGVMLGLHDLSGLFQS
Ga0214277_10058153Ga0214277_100581531F027342AIFFTASNSQKDLQELDAVKKIAAGKAFSVQSRHIKVNYLLLTRIRSSLGAFVDLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQALKAFIVRLWPREALPGSYFGLVRRVVEACPRFEVIKRSVCIEGARRALAHAKVHWGKLDSEKLVKDGPLLGK
Ga0214277_10058335Ga0214277_100583352F083289PGHKGTITVHGSWKIALECEEGDAAYAESHCAAEELKFYKDNVDPTEMTSLKKPTTEHEPMMKFKSADGTKLVDFVPGDSSKQFSISANLDPK
Ga0214277_10059627Ga0214277_100596273F020492MGLQAVLLTSGALTGEVNTLKQSLERSENELGRAKKQLEDKEGE
Ga0214277_10062345Ga0214277_100623451F091813SSDTVPDGTLAVVPLPEVDATLDVSKPANTRPRRPSRTSQPEPSADEQKKKRRRLRRVSSFDEDASTLAPAAEEMTATGLADIDPNGCAPPAADPNEDAVCAVAVEDEEEENETPLTRKNSRQFVASGGSSGVPSPALSALIGLQELSMANFDQALEDMVPENLLLEPADVDATEICAAVPDAPVRHLCSPQAAAVGRGLHVVWWRALFVCCPSAQPRLGNHRA
Ga0214277_10066021Ga0214277_100660211F004815LEAFKARLDVALGSLVCWLATLHIAGDWNSMSIVVLFKPGHSMAL
Ga0214277_10068861Ga0214277_100688611F093003AYKPASPEHNTADRPPCGRDREASRSFTRTVPRHCSNSTRPQGNAPDLPDILEDKARQSRSIYGPRGRPTVRDDNRRAGHSKSGWAEQNRQRSFELRRDIAQYRGAAQPLCFTDYVMDHQIPEGFKTVNIESYDGTTDPAVWIEEYLLHIHMARGDDLHAIKYLPL
Ga0214277_10069264Ga0214277_100692641F098130MMPGPHPRRRPVRDDVRLTHVRDWAPPGWHWEVLPRGARRLVRYPASGPVVDSDLLWWRSHGPHSLQREPAPPEVVRRRVREEDEHVHRYMAAMDVRFFNTWQVLWVDDRRYDPVMVPCLWVSTAR
Ga0214277_10069756Ga0214277_100697561F048299MQVLSLSREDPLEEEMATQSSILAWRIPWTEEPGGLQSIDRKESDMTEHTHTQCSYED
Ga0214277_10072876Ga0214277_100728761F006329MKRIEEEKMKLELYGADEGDDHKMKMNVMRLKMDPMHLKIKKIRKYAIDSDAWYHYVLGSIVTLVAILIAFVLP
Ga0214277_10075407Ga0214277_100754072F020492MQASLLASAALTAEVDTLKQNLARSENELGHAKRQLEEKEGK
Ga0214277_10078553Ga0214277_100785531F034384VVVLAEFCQNFEEETGRLEVNLDPINSPVKDEVAMNVLRLESRVAAGVDYLARLKVATSRIYTTLWPRETLQNDLESLMTRLNEVPSRVQEWKKSSARCGADVALSLAPVHCKDSREDKLAALRVANTKKHGFWSFMETFIAVATRIAD
Ga0214277_10085681Ga0214277_100856811F105149MYQGGSSVKKGSKIAMREQDVELPRDADVRACEWPSDDSMVEAGFKEEIDAFVHNAELEDFLKDKCPQYYQLTDSFVRQFKCNCTRNSPSVIFDIYDTSYSMDLEDF
Ga0214277_10090160Ga0214277_100901601F020289MTEDEMVGWHHQLDGREFEQALGVGDGQGILACCSPWGCKESDPTERLN
Ga0214277_10093216Ga0214277_100932161F017089KISNTYIKKVDKKTATPYLIKRKKNGKVIAIKANKPANKGKGAKRIWVPKEIISTMKSTKKVWIPKGK
Ga0214277_10095912Ga0214277_100959121F034384ATSRIDSTLWPGETLPNDLESLVARLNTVPGRVQEWKKSSARCGADVALCLARVHCKDAQEDKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0214277_10103952Ga0214277_101039521F093003TASSLKKKQQQLRADQDLLADRWIEVLAAEEYELERPSKSYPKRKLLPRLEEEAYKPTSPAHNTTDRQPRGRDREASRPSTKAAPRRRSKSTKPRGNAPNLRDILEDKARQIRSIYGSRGHPTTRDDNRHARYSNSGRAEHSRQSSFELRHDIAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYDGTTDPAVWIEGYLLHIHMAHGDD
Ga0214277_10106516Ga0214277_101065161F011632WAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTIGDGXMVGLDDPVGLVQP
Ga0214277_10106967Ga0214277_101069671F068298WAAQRGGGVTDPGGVQGTFGRYIERHGLARSIGDG
Ga0214277_10108149Ga0214277_101081491F093003MATASSLKKKQQQLRADQDFLADRWTEVLAAEEYKHDRPSKSYTKRRLLPQLEEEAPKPTSPAHDAADRPPRGRDKEASRPSTQAAPRCRSKNTKARGNAPDLRDILEDKARQTRSIYRSRGRPTTHDDNRHAGYGKYGQAEHSRQSSFGLRRDIVQYRGAAHPLC
Ga0214277_10109814Ga0214277_101098141F027342FADLLHSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHRVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGTRRALAHAKVHRGKMDAQKLVTDPPPEGKEHRKPEMYYKSVMKGTRTIAGECSKDVIFE
Ga0214277_10113597Ga0214277_101135972F039656MEEELCLVDSGATNSILREIKIFQTLKKVNGDILTIVGRDTVIVGTGRAIFTLPGGTQVTTKDALLYPDLS
Ga0214277_10120366Ga0214277_101203661F006329MKLESYVDDVVDDHKMKMNAMRLKMDAMDLKIKKIRKYAIDNESWYHYAVGSIVTLVAIFIIFVVMRVSFL
Ga0214277_10122857Ga0214277_101228571F067310MTRLNEVPGRVAEWKKSSARCGADVALSLVRVHCKEAREEKLAAIQVANTRKHNFQDFMETFIAAATRIADGIDLDEFVAPSSPPHEE
Ga0214277_10130817Ga0214277_101308171F076912LEKSTLLCNGKGSNADKVQDSETSLLVSKKADKNYIEDTETTPKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVMRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS
Ga0214277_10131415Ga0214277_101314151F034384MNVLRLESRITSATSYLVRLKEVVSRIESLLWPRATLQNALESLMTRLNEIPDRVQEWKKSSARCGADVALSLARVHCKEAREDKLATIKVTNTKKHDFQSFMETFIAAATQIADGIDLDSFVEPASPPPAK
Ga0214277_10136606Ga0214277_101366062F083289LQLKMPGHNGTITVHGSRKVALECEEGDAAYAESVCATEELKFYKDNVDSTDMTSLKKPTTENEPAMKFKSADETKLVDFVPGDSSQQFSISANLDPK
Ga0214277_10147742Ga0214277_101477421F006329ELYVADVVDDHKMKMNAMRLKMDAMRLKLKKIRKYAIDNEAWYHYAVGSIVTLVAIFITFVVMMVSFP
Ga0214277_10150696Ga0214277_101506961F086390CHMCVPDLSVLKSAMLGDKHYNLGAIVARRLHNNRLHGDFFGGIYATCIANFLGIAIREDDIELPPTCLDYEAMVRHHFVERNDQFLQYRLIFDRRRTYHVALPASTFFDFQAKGRYFITREEAEEYKRRAEIARLQAAAHDAMTAASQYDPNYNFGYPPSQPWQ
Ga0214277_10152811Ga0214277_101528112F052316MVKTRYTKLDPNHMARVGPLGSDGKEVPVSLVYDQVKVAAKYSQQDCKLDSLLDGIEEEMFESK
Ga0214277_10160947Ga0214277_101609471F034384VETGLDPINSPVKDEAAMNVLRLESRVAAVVDYIARLKVVTSRIATILWPRETLQNDLESLMTRLNEVPSRVQEWKKSSARCGVDVALYLVCVHCKDVREEKLASLKVANTKKHDFRSFMETFIAAATRIADGIDLDEFIAPSSPPLEE
Ga0214277_10161471Ga0214277_101614711F020828RSVSDVAAFYRAKEGGSTEKVFWSQYAEAEHPVPLRDQLKQLVELQKVAEQAMKGLIARLWPGEAMPGSYFGLVRRMVDACPWIEVVKRSVCIEGARRALARAKVHWGKLDAEKLLTDAPPPGKEYRTPEMYYNGVLKGARHIADECSKDVIFE
Ga0214277_10162419Ga0214277_101624191F081962VPTHLAEVLRRLAVLPQRVQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQRDFAACVKIVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAISLVPPTRKHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVLGTAGGAERDEPEAST
Ga0214277_10168501Ga0214277_101685012F076748MRFIQLPDDSPPLYLSKSSFSQSDSSWFDWKDEEAMLFPNWETEIT
Ga0214277_10173036Ga0214277_101730361F020828VPLSDQLKQLVELHKVAAQAMKGLIVRLWPGEAMPRSYFGKVRWLVDACPWVEVVKHSACIEGARRALARAKVHWGRMDAEKLVTDAPPTGKEYRTPEMYYKGVLKGARMIAGECSKDVIFE
Ga0214277_10176113Ga0214277_101761132F004001VAPSLEVFKSRVDVALRDVVSGHGGDRLAVGFDDLRGLFQP
Ga0214277_10179217Ga0214277_101792171F035626MAPSIISNNVVQGETFLPGQIFVFGSFTPRANLLGHLEQIDSYAPGHQIRFGSLNYTADIRGDLIFDGFESITGAPCSHDEHDLDLSSDSIQEITPAV
Ga0214277_10184264Ga0214277_101842641F093003YKLERPSKSYPKCRLLPQLEEEAPKPTSPAYDAADRPPRGRDREAFQPKAQPAPRRHSNKKAWGNTPDLRDVLEDKAKHARSIYGSRGRATMRDDNRHTGYSKSKSGRAEHSGQDSFELRLNIAQYRGAAHPLCITDEVMDRQIPKGCKPVNIESYDGTTDPAVCIEDFLLHIHMARGDDLHAI
Ga0214277_10184883Ga0214277_101848831F001813MTSASSGVQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0214277_10187464Ga0214277_101874641F083289HGSWHRKVALECEEGDAAYAESVCAAEELKFDKDRVDPADMTSLKKPTTEHHPALKFNLATDTNMVDFVPGNSSKQFSISANLDPK
Ga0214277_10187773Ga0214277_101877732F035108MPISTGDQLPELLQLLEQVRQAMSGVVQALWPALSLPEGLGELAEKLQGAPQRFRLWKISACRRGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKVIPVSLVYSQVELAAKFSQR
Ga0214277_10188375Ga0214277_101883752F052316MGKPRYAKADLNHMAVVRPGGPDGQEIPVRLVYDQVALAAKYSQQDCRLDSLLDGIEEEYSQFK
Ga0214277_10195324Ga0214277_101953241F020492MGLQATLLTSAALTAEVNTLKENLELSENELGRAKKQLENKEGE
Ga0214277_10195435Ga0214277_101954351F027342MSSPGAFADLPRSVSDAAEFYRAQEGSSMEKLFWSQYAGAEHPIPLSDQLKQLVELHKAAEVAMKDLIVRIWPGELLPTSYFGLIKRVVDSCPRLEVIKRSVCIEGACRAFARAKVHWGKLDAEKLVKDGPPEGKPHRVPEKYYDGIMKGACLVADECTKDIIFE
Ga0214277_10200436Ga0214277_102004361F004001SLEVFKSHAAVALRDVVSGHGGDGLTAGLGDLSGLTEP
Ga0214277_10203723Ga0214277_102037232F079404PDPVRIGLPEFNNASLKKCLSWRPRNPQREADRDVLYLMSRIRLLAHSGLTMIKVMDVWITRGVQPLQYRGHPMWDFNGEDDATRCGRKGPDSAATLTRILSALYKGEEEEFLRVNPEGGFSMYNPPSWVSGHFHLPIRFRNSRS
Ga0214277_10208370Ga0214277_102083702F035626VSSLLGPMASPIINSDAIQGETFLPGQIFVFGGFALRANTLGHLEQIESYAPGRHVRFGSLNYTADIHGDLIFDGFEPQPSAPRCHDGHDLALPPDSA
Ga0214277_10213380Ga0214277_102133801F076748DIFFIPIRMRLIQLPGDSPTLYVSKSSFLQSDSSWFDWNDEEAVLLPNWETGIT
Ga0214277_10217809Ga0214277_102178091F027342MQSKHVEVNYRLLTRIRSSLGAFTDFPCNVSNAAQFYQAKDRSSTEKLFWSQYAEAEHPVPMRDQLKQMVELHKAADQGMKSFIVRLWPSDALPNSFFILVRRLVDACPWLEVVKRSVWIEGAHRAFARAKVHWAKMDTEKLVKEGPPQGKEHPHPEMYYEGVLKGARFVADECAKDVILNELARVILYYENLFICAMQRLFEFKILPSVR
Ga0214277_10222299Ga0214277_102222991F006329MKLESYVADVIDDHKIKMEKMHLKIRKIRRYAIDSEAWYHYAVGSIVTLVVILIVFVVAFKCFS
Ga0214277_10223220Ga0214277_102232202F020492MRMQASLLASTALTAEVDTLKQNLARSENELGHAKRQLEEKDGK
Ga0214277_10232918Ga0214277_102329181F050219MSEAAKKAAAEMKLSLDEEKNFGFLIAMSKTNTEKITKEILEGLSE
Ga0214277_10239888Ga0214277_102398881F035108PAEEMPGSTGDLLPELLQLLERVRQAMQGVAQALWPSISMPEGHGELAEKLKGARWRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCRLDSLMDGIEEEFNQSN
Ga0214277_10240693Ga0214277_102406931F093003RSLKKKQQQLRADQDLLVDRWTEVLAAEEHKLERPSKSYPKRRLLRRLEEEALDAADRPPCGRDREASRPSTHATPRTKAREYAPDLRNMLEEKARQTRSIYGSRGRPTARDGNRHAGHKFGRAEHSSLELRHDVAQYRGAAHPLCFTDEIMDHQIPEGFKPVNIESYDGTTDPAVWIED
Ga0214277_10241225Ga0214277_102412252F096317VLNVNKQAVLLAAAARTAKIAGLTQDLERAQGELGLARRQLEENKGE
Ga0214277_10242590Ga0214277_102425901F029075LVAAQVQGFGPAHATATTEFLAASTAEGGNEYGGSVSEFFDFTDSGSSVEWTEESSEEDLDYFAALDVAAAEASPHAADAPDVPGPSTGRRRRRAVAKRRVSAEEGARLRVSRAGRQELLSLPAAVSTGEGELRSLFAGEELRIMLFNYREMGIIPKVEPM
Ga0214277_10245252Ga0214277_102452521F038012MIIEFQPPCDVQGRQPPDQAAQRHIQPGLECLQQQGIHNLLGQCVPARHH
Ga0214277_10250331Ga0214277_102503311F035626MAPSIIGNDAVQGEVFLPGQIFVFGGFALRANSLGHLEQIESYAPGHEVKFGNLNYTADIRGDLIFDGFEPMSDAPHSHDEHDVTLPSNDVREMASATTPAFNTEQVTL
Ga0214277_10250528Ga0214277_102505281F006329LKEKNKKIEEEKRILELHVADVVDDHKIKMDAMRLKIRKIRKYTIHTEGSYHYAVGSVVTLVVIMIAFVVALKGFT
Ga0214277_10251906Ga0214277_102519065F013050MSKGKQPRTRVKVPKLLLSEIKKVFIKVNKEIGLEAA
Ga0214277_10252817Ga0214277_102528171F079404FLGIDPHFALWKRLFCLVARSYEGSIYQVGRAKIWRIVGTGYLSGTPKKVSEDWPSEWFYMEDAPLPDPVWIGLPEFSSAPLKKRLSWRPRSPQQEDDRSVHYLMGRIRLLAHSGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGENDATRHGRQRPGSAEDLVKILSSLY
Ga0214277_10255952Ga0214277_102559521F081962LKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTAFDQKDFAACVKTVRPVATLIGNDTDLTKYQPGYNAENHRIPTPRYEALSLIPPARQHTFAPEIDPAGLIDEEAQFEVLSGIDWKSSTFRILGSAGGEERNEPETSTQQAL
Ga0214277_10263018Ga0214277_102630182F096317MQASLLAAAARTAEVAALKQDLERSKEELGLTKRKLEENKGK
Ga0214277_10265417Ga0214277_102654171F001813SPGGVQRAFGCCVKGHGLAETIGEGLMVGLDDPVGLFQP
Ga0214277_10265603Ga0214277_102656032F083289VYPQLKMPGHKGTITVHGSRKIALECEEGNAAYAESVCATEEFTFYKEQADPADMTSLKRPTTKHDPTLKFKSATDTKMVDFVPGDSSKQFSVSANLDPK
Ga0214277_10267849Ga0214277_102678491F093003GDEASLDDDEFIVPEDPIEQERFKRRLMATANSLKKKQQQLRADQDLLADRWTEVLAAEEHELDRPSKSYPKCKLLPRLEEEAYEPASPADNTADRPPRGRDREASRPSTRTVPRHRLKSTRPQGNALDLRDILEDKARQSRSIYGSRGRPMIRDDNRRAGHSKSGRAEQNRQSSFELRRDIAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYEGTTDPAVWIKDYLLHIHMACGDDLHAIKYLRLKLKGPARHWVNSLPAESI
Ga0214277_10268508Ga0214277_102685081F020492LLTSAALTAEVNSLKENLERCKNKLGHAKKQLEEKEGE
Ga0214277_10276746Ga0214277_102767461F032472MASSINNAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGRLNFTADVRGDLIFDGLEPQPSVPHFYDGHDLALPPNSALVAAQESAPVLSPEPIAQIEDQWMDTTSGASTSTAMEPNTNLDPRKTRDSEVPDSLPDSEPPAPLPIKSDRAPVMEFTATDIFQYSPFGDILNSLEHLSLSGEPW
Ga0214277_10278568Ga0214277_102785682F001813VQGTFGHCVEGHGLARSIGDGRMVGLDDPVGLFQT
Ga0214277_10282818Ga0214277_102828182F035108VMSVGMLTGRPAEEMSGSIGDLLPELLQLHERVRQAMQGVVQALWPCISMPEGLGELAEKLKGARRRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYYQQDCKLDILLDGIEEEYTQSN
Ga0214277_10283846Ga0214277_102838463F035108VSVGVLTGRPAEEMPSSTGDPLPELLQLHERVRQVMSGVVQALWPSVPLPEGLGGLAEKLQGVRRRLRLWKISACRQGAREAWAMVKTRYPKSDPNHVAEVGPVGTDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSV
Ga0214277_10286152Ga0214277_102861521F032472SIKRARTWVKHLVPCLLLPSGLDAQFGTPYPRSAGFDTDIGAFIESSSVSSPLGPMAPSIINNNVVQGETFLPGQIFVFGSFALRAKSLDHLEQIESYALGHQVRFGSLNYTADIRGDLIFDGFEPRPSAPHYLEGHDIALPSKSVLEAAYAPAPIFDSEPAAFVEDERLDVTSGAAILK
Ga0214277_10290750Ga0214277_102907501F032472IGAFIESSSMSSLLGPMAPSIINNDAVQGETFLPGQIFVFGDFALRANSFGHLEQIESYAPGRQVRFGSLNFTTDIRGDLIFTGFEPQPSAPHCHDGHDLALLPDSALEAAHESAPTLDSEPAVQIEDGWLDTASGAATSTAIEPNTDFVPFEARDSQVSDPLPDSEPPAPPLIKFDRVPIMEFTAADIFQLSPFGDILRSLKHLSLSGDP
Ga0214277_10296414Ga0214277_102964141F059631RDPEWVAAPEFRSGPPTRLTSWKEMGLSWGKKEELAGLQTCVQTLLDKKLKLVNVVQVMLICLILPCQQWAFNLWEFDLARHQTLSRLFDMTYEDAWKVLFKGAEAPASATEDRGFNMQRHAHAVSCFFLLQGISFS
Ga0214277_10296443Ga0214277_102964431F020828MPLSDQLKQLVELHKAAELAMKGVIVRMWPGEPLPGSYFGLVRRLVNACPRLEVIKQSAYIEGARRAFAWAKVHWAKMDAEKLVKEGPPEGKEHRHPEMYYNSVLKGSRLVAEECAKDVIFE
Ga0214277_10296748Ga0214277_102967481F105149MSRKMYQGGSSTKRGPRRAMREQDDEPPREAEVRSCEWLSEEFMVNAGIKDEFDAYVRNADLEDFMQDKCPQYYYLTDSFVRRFKFTSSRNSPTVLFDIYYKPYTMDLEDFTTSCKLPQWGSVNEPRKSEYKYFLASITVGESREIAQATIGSIHFPAMHYFALFICRCINSKDEAC
Ga0214277_10302660Ga0214277_103026601F035626MAPSIINNDAVRSETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLDFTADIRRDLIFDGFEPQPSVPHCHVRHDLALPPDR
Ga0214277_10304072Ga0214277_103040722F079404KELFCLVPRSKKGSMYQVGGAEVWRIAGTGYLSGTPKKASEDWPSEWFYIEDVPLPDPIRIGLPEFDSAPLKKRLSWRPRSPQRESDRNIVYLMGRIRLLAHSGLTMIRVMAECIMRGVQPLQYRSHPMWDFNGEVDATRYARKGPDSVAALLNILSTLYKGEEEEFLRVNPQGGFTMYNPPSWVSGQFNLPVRFIFP
Ga0214277_10304173Ga0214277_103041731F002471CKDFDIDACSDHLVSISKLNEELASLNAQLKTSKNEFDKLKFARDAYTIGRHPSIKDGLGYKREAKNLTSHKAPISAKEKGKAPMASSTKKNHAFMYNDRRQSHRSCNAFDSHAYDSYAMFAPSSSYMHGRDMPRKNIHHVPRKNIVHVPRKVMNGPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKEILTNLVGPNKSWVPKSQA
Ga0214277_10307458Ga0214277_103074581F035626VPSPKGLMAPSIINNNAVQGETFLNGQIFVFGGFALRANSFGLLEQIDSYAPGHQVRFGSLNYVADVRGDLIFAGFETAEIAPGHPDEHDLNLLSDRIQEIAPVTALDIDPEHIAPSKD
Ga0214277_10310422Ga0214277_103104221F032472SSPLGPMATLIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYPTAIRGDLIFDGFEPQPSAPHCLDGHDIALPPNNALEAAHASVPTIDLEPTALIEDQRLDAASGAAISEAIEPNSSPALRMARDPEDPDSSPSSEPPAPMPIESDRAPIMEFTTADIFQHSPFGDILNLLKSLSLSGKPWPNYGQQ
Ga0214277_10311824Ga0214277_103118243F052316MVKTRYAKADPNHMAEVGPAGPDGQEIPVSLVYDQVALAAKYSQQDCMLDRLLDGIEEEYGQSI
Ga0214277_10312500Ga0214277_103125001F059631PRDPKWVAAPEFRSGFPTWVTSWKETGLTWGDSKEQTGLQSCIKTLVNKKLKLVNVVQIMLIRRILACQQRAFNLWEFDPTQHQTLSRLFDTTYEDAWKVLFKGAEVPPSLTEDRGLSTKRRAHSVSSIHPVGYLFPLA
Ga0214277_10314772Ga0214277_103147721F035108MLTGRPAEEMPGSTGDLLPELLQLHERIRQAMRDIAQALWPAHSVPEDLGELAEKLKGARQRFRLWKISACRQGAREAWAMVKTRFTKSDPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSE
Ga0214277_10318596Ga0214277_103185961F094706MVLKFLKGSFDGLKGYAMGRMTKSRRGKLYIDNAGWGPEADSIEYGYRVPFGGIHVFIGKIGEPTPEPDICTDIIKTARRASPSPVQPEARHVFIGVVHGSGHEDGPVSERETVVCSDDESSGETESLYQLQ
Ga0214277_10327446Ga0214277_103274462F068298LEWAAQRGGGVTEPGGVQETFGRCVEGRCLVRTIGDG
Ga0214277_10327869Ga0214277_103278691F020828AIPFPTATFGLVRRLVDACPWLEVIKRSVCIEGACWAFARVKLQWAKMDVEKLVKEGPPQGKEHRHPEMYYEGVLKGARLVADECAKDVMFE
Ga0214277_10329339Ga0214277_103293391F004001PLEVFKNRGDVALRDVVSGHGWDGMTVKLDDLSGLFQSH
Ga0214277_10335246Ga0214277_103352461F076912MPDGMQKSAEGCERNPTYIAAKKAKHLQDSVITQKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVLRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS
Ga0214277_10336637Ga0214277_103366371F086390LGDKHYNLGAIVARRLHNNRINGDFFGGIYATRLANFLGIPIREYDIELPPVYLDYEAIVLHQFVERNDQFLQYRLIFDRRRTYHVALPASTFFDFQAKGRYFITREEANEYQRRTETARLQAAAHDAIAAASQYDPSYKFGYPPGQPWP
Ga0214277_10336751Ga0214277_103367511F081962MFANTGPRSTNLKQNMLIKLKAVYTLVEQLYTGSQRALAVVALSNDVPHLLQDVLKCIVVLPQWVQDLRRASSRAGAVAALSPAKAWIPELDPVDLALGYPSLKEDGTVFDEQDFTACVKDIRPMATLIGNDTDLTKYQPGYDNENRRIPTPPYDEVSLIPPTRKHVFAPEVDPAGLIDD
Ga0214277_10340111Ga0214277_103401111F020492MQAALLTSAALTAEVNALKESLERSESKLGHAKKQLEDKEGK
Ga0214277_10343684Ga0214277_103436841F006329MPTDPIVERLNLVEEENNLLKEKIKKIEEKKMILELHVADVVDDHKIKMDAMRLKIRKIRKYVIHTKAWYHYVVGSIVTLVAIMIAFVFALKCFT
Ga0214277_10348125Ga0214277_103481252F105149MFRKMYQGGPSRKQGPRLAMRDAEPCEWPSEDFMDRAGIKEEFNAYLRNADLVSFEAEKCRQYHYLTSSFVRRFEFSSSRNSQTVLFDLYENSYTMDLEDFNTGCKLPQWGSPDEPRKSEFRVFLASITVGESRDITQATIG
Ga0214277_10351442Ga0214277_103514421F006329MELELHVADVVDDHKIKMEKMRLKIRKIRKYAIDSEAWYHYAVGSIVTLVAILIAFVVAFKCFS
Ga0214277_10361770Ga0214277_103617702F035626MFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADNRGDLIFDGFEPRLSAPHCLDGHDLALPPDSAQSAAQVSAPTISSEPTALVGDGWLDAAQEPQSLWR
Ga0214277_10364026Ga0214277_103640261F052316MVKTRYTKLDPNHMARVGPVGSNGEEIPVSLVYDQVQVAAKYSQQDCRLDSLLDGIEEEVFKFK
Ga0214277_10364096Ga0214277_103640961F067310VLRIDTALWPGATLQKWKKSSARCGADVALSLVRVHYKEAREEKLAAIKVANTKRHDFQSFMETFIAAATRIADGIDLDEFVEPASPPRAE
Ga0214277_10367002Ga0214277_103670022F032472LGHLEQIESYTPGHQVRFGSLNYTADIRGDLIFDGFEPQPRAPHCHDGHDLALPPNSALEAAPVSALTPSSEPITPIEDGWLDTASGAAISMVIKPNTSPILCEARDSKEPDSSPDSEPSAPLPVETDWAPIMEFTAADIFQHSPFGDILNSLKSLSLSGEP
Ga0214277_10370019Ga0214277_103700191F035626MAPLIVNNDAVQGETFLPGQIFVFGGFALWANSLGHLEQIESYAPGRQVRFGSLNFTADIRGDLIFDGFEPQPSAPHYHDGHDLALLPDSALEAAHESAPTLNSEPAAQIEDGWLDTASG
Ga0214277_10377228Ga0214277_103772282F007409MSEDKKTAAETKLSLDEEKNLGFLIAMSKTNTEKITKEILEGLSEDNSDSDSYDVDSGVEDSEDRPWRPSHSVYGKSTIKENHLVNMR
Ga0214277_10377571Ga0214277_103775711F094706MGPAHDGFEFLKGSFEGLKGYAVGRMTESRRGKLYIDDANWGPDVGSIEYGYRVPFGEIHVFIGKIGESGPEPDTCTDIIETAQRARSARVKPAMKRAFVGFIHGVESEDRRASGDETVIYSDGESSTGET
Ga0214277_10379394Ga0214277_103793941F081962MVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARSGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEALNLIPPARQHTFAPEIDPAGLIDEEAQFEALSGINWKSSTFEVLGSAGGEDRNEPGTSTQQASEVSWRLIKHCSIF
Ga0214277_10381891Ga0214277_103818911F020492MGLQAALLTSVALTAEVNTLKQSLERSENELGRAKK
Ga0214277_10391526Ga0214277_103915261F034384MNMLRLESRITGVVDYLARLKVAMSRIDTSLWPMATLQNDLESMMAQLNEAPSRIQEWKKSSARCGADVALSLVRVHCREAREEKLAAIKVANTKRHDFQSFMETFIAAATRIADGIDLDKFVEPASPPPAE
Ga0214277_10392964Ga0214277_103929641F059631ITASIVVCEAFLRIPPHFGLWQKTFNVKPKVVSGQQAECGGAMVGKMPNVTWPEGSFAETVKGWQSAWFYITEPRDANWLAAPEFRSGIPMRLTSWQERGLTWGPSDELTGLQPCIQNMIERKIKLVNVVQVTLIHRVLPCQRRTYSLWAFEPAKHQTLLELFGTMHEEIWKVLFKAGETPPPVTED
Ga0214277_10393731Ga0214277_103937311F006329MTLELYVADVVDDHKMKMNAMRLKMDAMRLKIKKIRKYAIDNEAWYHYAVGSIVTLVAIFIAFVVMRVSFL
Ga0214277_10407506Ga0214277_104075061F004001LEVLKNRVGVALRDMVSGHGGGRLMVGLDDLSGYFQL
Ga0214277_10411815Ga0214277_104118151F032472PYPRSAGFDTDIGAFIESSSVSSPIGSMASSTNNAVQGETFLPGQIFVFSGFALRANSLGHLEQIESYAPGRQVRIGSLNFTADVRGDLIFDGLEPQPSAPHCDDGHDLALPPNSALVAAHGSASAISPEPIAQIKGRWIDAALEASTSMAMEPPTNLVPCETRDSKAPDSSPDSEPPAPLPIDPDWAPVMEFTAADIFQNSPFGDILNSLKH
Ga0214277_10413809Ga0214277_104138092F032472FALRANSLGHMEQIESYAPGRQVRFGSLNYTANIRGDLIFDGFEPQPGAPHCLDGYDLALPPDDTPEAAPAPAPTLSLEPTAPIEDGWLDTASGVAVSTAIEPNTSIILRMTRDSKVPDSLPDPESSAPPPIESNWTTVMQFTTADIFQHSPFGNILNSLKSLSLSGEPWPGYAQQDWDADDEEIRRPTHHPHCSHCR
Ga0214277_10414853Ga0214277_104148531F076748MPTPIRFIQLPGDYPPLYVSKSYFSQSDSSWFNCNDDEAVVFPNWETGIT
Ga0214277_10419420Ga0214277_104194201F096317VNKQASLLAAAARTSEVSGLKQDLERSKEELGLVKRQLEENKGT
Ga0214277_10422175Ga0214277_104221751F020492MYVNMGMQAALLTSAALTAEVDALKQSLERSENELSLAKKKLEDKEGK
Ga0214277_10440820Ga0214277_104408202F081962VLTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRFQELRRASARVKAIAALSRAKAFLPELDPAEIALGYPSLKEDGTPFDQKDFAACVKSVRPVATSIGNDTDLTKYQPGYDSENQRIPTPRYEAISLIPPTRKHTFAPEVDPAGLIDEEAQFEALSGIDWKSSTFQVMGT
Ga0214277_10442025Ga0214277_104420251F001813ALEWAAQGGGEVTNPVQETFGCCIEGHGLVRTIGNGWMVGLGNSMDLFQPW
Ga0214277_10446483Ga0214277_104464831F020828VPPSDQLKHLVQLHKEAEQPMKGHIVRLWPGEALPGSYFSLVRRLVDACPWVEVIKRSACIEGARRAIARAKVHCGRLDAERLITDAPPAGKEYRTLEMYYKSVLKGARKIADECPRDVITE
Ga0214277_10449944Ga0214277_104499442F037171MDGCMCACNRIENDPVEEPEELAGEAPEQQSVGGGKCPLTYLCPIHSLIHLPLYTFMPKD
Ga0214277_10450547Ga0214277_104505473F002002SRGASLVAQTVKRLSAMRETRVRSLGQEGPQEKEMATHSGTLAWKTPWMEEPGGLQSMGSQRVGHD
Ga0214277_10455281Ga0214277_104552812F105149MSRRIYQGGSLVKKGPRLAMREQDDELPRDAEVRACELPTDDFMVNAGIKDEFDAYVRNADLEDFLQDKCPQYYQLTDSFVRRFKYKCSRNSQSVLFDIYDKSYTMDLEDFTTACKLPQWGNVNDPHKSEFRDFLASITMGESRDIAQATIG
Ga0214277_10455329Ga0214277_104553292F020492MGMEAALLTSAALTAEVNALKESLERSESELGRAKKQLEDKEGT
Ga0214277_10460961Ga0214277_104609612F035108VSVGVLTGRPAEEMPGSTGDLLPELLQLHEHVRQAMSGVVQALWPSVSLPEGLGGLAEKLQGVRQRFRLWKISAYHQGAREAWAMVKTWYKKADPNHMAEVGPVGPDGKEIPVSLMYGQVELGAKYSQWDYKLDSLL
Ga0214277_10465372Ga0214277_104653721F076748MRFIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEQAVLFPNWETGI
Ga0214277_10469452Ga0214277_104694521F081962MLIKLKAVYTLVEQLYTVSQHALAIVALSDDVPYLLQDMLKWLASLPQRIQDLRRASARAGAVAALSLAKVWIPELDPADLALGYPRLKEDGTVFDEHDFTAGVKDICPVATLIGNDTNLTKYQPGYDSENRRIPMPLYDDVILTPLIRKHTFAPEVDPAGLIDDEAEFEALSGIDWASSTFQDRATDGEAEKDNPDSSSQPN
Ga0214277_10473475Ga0214277_104734751F034384VRKLTYPWIVNAEFCQNFEEETGRIEPGLDPINSPVKDETAMNLLRLESRIDGAVDYLARLKVAMSQIDLALWPEATLQNDLESLMTRLNGIPDRVQEWKKSSARCGADVALSLVRVHCKEVRQDKLAAIKVANTQKHDFQTFMETFIAAATRIADGVDLDEFGEPASPPPPE
Ga0214277_10480139Ga0214277_104801391F105149MSRKLYQGGSSRKQGPRLAIREQDEEPPREAHVRPCEWPSEEFMVKAGIKDKFDAYMCNANLEDFMQDKCPQYYHLTDSFVRRFKFTSSHNSRNVLFDLYDKSYTMDLEDFTTACK
Ga0214277_10482231Ga0214277_104822311F052316RYMKADPNHMAEVGPVGPDGKEILVSLVYGQVELAAKYSQRDYRLDSLLDGIEEEFNQSN
Ga0214277_10483387Ga0214277_104833872F081962MLIKLKAVYTLVEQLYSGTQRALAVVALSTPHPRLLQDVLKSLAFLPQRIQDLRRSSSRAGAVAALSRAKAWLPELDPADLALGYPSLKEDGNAFDDHDFHACVKAIRLVATLIGNDTDLSNYASACDSNNRKIPNAPYDQISLIPPIRKHTFAPEVDPAGLIEDEAEFEALRSIDWAS
Ga0214277_10484026Ga0214277_104840262F083289RPCYVYLQLKMPGHKGTITVHGNRKVALECEEGDAAYAESACAAEELKFYQDNVDPADMTSLKKPTTEHDPAMKFKSAAETKLVDFTLGDSSKQFSISANLDPK
Ga0214277_10485170Ga0214277_104851701F067310NDLESLMTWLSEVHGRVQEWKKSSARCGADVALSLVRVHCKEAREDKLVAIKVANTKRHDFQSFMETFIAAATRIADGIDLDEFVEPASPPPAE
Ga0214277_10485188Ga0214277_104851881F053764MVNTEIRLIIFFAAKDGEAPYIQQKQDQEQTVTQIMNSSLANSDLKKVQKTTISFR
Ga0214277_10485471Ga0214277_104854711F033854EWPSGKVAPDMEVCMKRKCEIEFLHAEKIVPIDIHXHLRNIYGDQTVDVSTLKE
Ga0214277_10485718Ga0214277_104857181F103019HHAGKTSSIPPPAGGLSATIVVVTRRWKKYHVVAAVEGHELKSPETKHRPGPERLLETAYLELDGELFVSTQQAPT
Ga0214277_10492260Ga0214277_104922601F093003KKKQQQLKTDQDLLVDRWTEVLATEEHKLERPSKSYPKRRLLPRLEEETLDAADRPPRGRDREASWPSTQAAPRTKALEYAPDLRDMLEDKARQTRSIYGSRGHPTARDGNRHAGHKFGRAEHSRQNSLELRHDIAQYRGAAHPLCFTDEIMDHQIPEGFKLVNIESYDGTTDPAVWIEDYLLHIHMARGDDFHAIKYLPLKLKGLAGHWLISLPTGSISCWEDLEAAFLDS
Ga0214277_10495704Ga0214277_104957041F059631VGKIANVTWLEGAFVETIKGWQSGWFYITEPRDPEWAAAPEFRSGIPTWLTSWKETGPSWGNSAEVTGLQTCVKDLIDRKVKLVTVVQVILFRRILPCPRRAFSLWEFDPAQHQTLSRRFDTKHEDVWKVLFKGSEVHPPITKDHGFCAKRQASAVSLVYPLQGTCFS
Ga0214277_10496210Ga0214277_104962102F035108MSLGVLTGRPAEEMPGSTGDQLPELVQLFERVRQAMSGVVQALWPSVSLPEGLGELAEKLQGARRRLRLWKISACRQGAREAWAMVKTRYPKTDPNHMAEVGPAGPNGKEIPVSLMYGQVELAMKYSQ
Ga0214277_10497710Ga0214277_104977101F068298MAAQTGGGVTNPGGIQGTFGCCVEGHGLARTIGDG
Ga0214277_10502578Ga0214277_105025782F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARSGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATIIGNDTDLTKYQPGYNAENQRIPTPRYEAINLIPPARQHTFAPEINPDGLIDEEAQFEALSGINWKSSTFEALGSAEAEDEPGTSTQQAS
Ga0214277_10505907Ga0214277_105059071F006329LKEKIKKLKEEKMILELHIADVVDDHKIKMDAMRLKMRKIRKYAIHTEAWYHYAVGSVVTLVAIMIAFVFALKCFT
Ga0214277_10506523Ga0214277_105065232F020492MQAALLTSAALTAEVNALKESLEVSESELGRAKKQLEEKEGT
Ga0214277_10507461Ga0214277_105074612F096317MQASLLAAAARTAEVAALKRDLERSKEELGLTKRQLEENKGK
Ga0214277_10510930Ga0214277_105109301F020492MGMQAALLTSAALTAEVDALKKSLERSENELGLAKKQLEDREGR
Ga0214277_10513542Ga0214277_105135421F081962LVEQLYSGSQRALAVVALSHTPRHLLQDVLKHLDVLPQRIQDLRLSSARAGAIAALSQATAWIPELDPADLALGYPSRKEDDTVFDDHDFIACVKVIRPVATLIGNDTDLTKYSLGYDSENRRIPNIPYDEVSLIPPIRKHTFSPDVDPAGLIDDEAEFEALSGSDWASSTFQ
Ga0214277_10513924Ga0214277_105139241F093003ADQDLLADRWAEVLAAKEYELEHPSKTYPKRRLLPRLEEEAPKPTSPEHNTAARPPRGRDREASRPYTQAAPRRRSKNTKARENAPDLRDILEDKARQTRSIYGSRGRPTIRDDNRHAGYGNSGRAEHSRQSSFELRRDIAQYRGAAHPLCFTDEVMDHQIPEGFKP
Ga0214277_10519376Ga0214277_105193761F059631FGLWLKTFNVKPKVVRGNQAKCGGAMVGKMANILWLEGSFVETLKGWQSGWFYITEPRDAEWVAPPEFRSGPPTRLTSWKETGPSWGKKGELTGLQTCIQTLVDKKLKLVNIVQVMLIRLILPCQQRAFNLWEFDPARH
Ga0214277_10522188Ga0214277_105221881F027342MQSKHVEETFLLLTRVRSSPGALTDLPRSVLDAAEFYQAEEGSSVDKLFWSQYTGTEHPMPLSDQLKQLVELHKAAEQAMRGLIVRMWPGEPLPGSYFGLVRRLVNACPWFEVIKRSVCIEGARRAFALAKVHWAKLDAEKLVKDGPPEG
Ga0214277_10528110Ga0214277_105281101F059631CEAFLRIRTHFGLWLKTLNIKPKVVRGQQAECGGAMVGKMPNVIWLEGSFVETIKGWQSAWFYTTEPRDAKWAAAPEFRSGIPKRLTSRKESGLTWGASEDLTGLQTCVQKLVDKKLKLVNIVQVMLIRQILPCQRRGFNMWEFNPAQHQTLSGLFDTTYEDVWKVLFKGAEVPASTTEDRGFSLQCPADEVSDFATCFP
Ga0214277_10529872Ga0214277_105298721F027342FFMQSKNIKVNYLLLTRIRSSPGAFADLPHSVSDAAAFYRAEEGSSTEKVFWSQYVEAGHPVPLNDQLKQLVELHKVAEQATKGLIARLWPGEAMPRSYFGLVRRLVDVHLWIEVVKCSFCIEGARRALARAKVHWGRMDAEKLVTDAPPPGKEYRTPEMYYKGVLKGARRITGECSKDVIF
Ga0214277_10538683Ga0214277_105386832F027342MQIRNIKVNYLLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYSEAGHPVPLSDQLKQLVELHKAAEQAMKGFIVRLWPGEALPGSYFGLVRRLVEACPRLEVIKRSVCIEGARRALARAKVHWGKLDGEKLVRDGPPPGKEHRKPENYYKDVLAGARLMADECTKDVIF
Ga0214277_10540673Ga0214277_105406731F086390IGSIHFPAIHYFVLFIGRCITAKDEACHMCAPNLSILRSVVLGDQAYHMGAIVARRLHLNRRNGDFFGGIYATRLANFLDVDIREGDVELPTSYLDLDPMFSHQFIERTGPPYQYGLIFNKWHVVRVALPAPTFFDFQARGRYIITREEAVEYERGVEAAQRRAAAQQAVAAASQYDPSFTYGYPPGHPWQ
Ga0214277_10541125Ga0214277_105411251F002471PMATSAKKNHAFLYHDRKNSRNAFRSYDAFDSHAYDSYAMTASSSHVVHDRKVGRRNVIHNMPRRNVVNAHRKVHGPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKEICTNLVGPNKSWVPKSQA
Ga0214277_10549710Ga0214277_105497101F035626VSSSPTFNNSVQGETFFPGQIFVFAGFALRANSLGHLEQIESYAPGHQVRFGSLNYTANIRGDLIFDGFEPLPCAPRGHDEYDLALPSDSVQEIAPTATLTNNSEPV
Ga0214277_10550328Ga0214277_105503281F033854MAAEGQSDKMMPDTAAQMKQKCVIAFLHAEKIISIRIHQCLLKIYGDQTVDVST
Ga0214277_10560034Ga0214277_105600341F092835PKRFPLLLNPKVRIHVGHHHSQFWTILPRFVDYYSLFWGPGEVSTINEPWGAFMFRSSTLAVFADSEPFRGLLLTIFGPQTNFHSC
Ga0214277_10560122Ga0214277_105601221F059631TIKGWQSGWFYITEPRDSKWAATPEFRSGFPTRLTSWKEKGLTWGDSEELTGLQTCIQKLVNKNLKLLNIVQVMLIRRILPCQQWALKLWEFDPAQHQTLSNFFDTTYEDAWKVLFKGAEAPASATEDRGFSSRCWANEVSCSTLYGTLFSHSLTLCGI
Ga0214277_10561463Ga0214277_105614631F032472GHQVRFQSLNYTADIHGDLISDGFEPQPSALPCLHGHDVDLPPNSALEATHASVPTIDLEPTAPIEDQRLDAASGAAISEAIEPNSSPALRMARDSEEPNSSPNSEPPVPLPIESDWALIMEFTAADIFQHSPFGDILNSLKSPSLSGEPWPDYG
Ga0214277_10562367Ga0214277_105623673F098130MPGPHPRRRPVRDDVRLTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQYLRGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDLY
Ga0214277_10564801Ga0214277_105648012F057793MAKKSVTPSIRMNEEEYLKLKALKEKYNVSWNELIKYANRVLSEEMNKHES
Ga0214277_10565811Ga0214277_105658111F079404VGGAEIWRIAQTEYLPGTPKKASKDWPPKWFYVDDVPLPDPVRTGLPEFTNTPLKKRQSWRPRSPQEEDNREVFYLMSQIQTLAKSGLTIIEVMSICVIRGVQPLQYRGKPMWHFNGEDDASRCSRKGPDSATSLARILSELYKGEEEEFLRIKPRDGFSMYNPRSWVSCHPLLTFVHSYLLCHNYLPCCSKTGSKEGHERVQ
Ga0214277_10575025Ga0214277_105750252F052316MEDIGMLTRCKGSLARVKTRYTKADPNHMAGVVPIGSDGKEIPVSLVYDQVALAAKYSQQDCRLDNLLDGIEEEFSQSK
Ga0214277_10579492Ga0214277_105794921F037171MYVCARIENDPVEEPEELAGEAPEQQSVGGGKCPLTYLCPIHSLIHLPLY
Ga0214277_10581911Ga0214277_105819111F094706VTNPRQLAPTVGLSHDGFEFLKGSFNGLKGYDVGRMTKSRRGKLYIDDTGWGPEACSIEYGYRVPFGGIHVVIGKIGDPGPEPDTCTDIIETARRASPSPVQPMARHVFVGVIHGAEYEDGPASDGETVVCSDDESSGETESLYQLQDGRISGGSEGNSILDSPDLPNRGAIFMAG
Ga0214277_10582009Ga0214277_105820091F059631PPHPAPLRHVVKTFNIKPKVVRGQQAECGGAMVGKMPNVIWLEGSIMETIKGWQSAWFYITEPRDAKWVAAPEFRSGFPTRLTSWKEKGLPWGSSVELEGLQKCILNMTSKKLKLVNIVQGMLFRRMLPCQQWAFNLLQFDLAQHQTLHEIFDTTHKDVWKLLFKGIEVPPSLTKDRGLSAKRPA
Ga0214277_10583872Ga0214277_105838722F035626MAPMIINGDAVQGETFLPEQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSVNYTADIRGDLISDVFEPKTGAPYSRDEHGLDFPSDGVQEITPAAALALNVVQIMPSE
Ga0214277_10587498Ga0214277_105874981F001813QRDGGVTDPGGVQGTSGHCVEGRGLVRTTGEGRMVGLGNPGGLIQT
Ga0214277_10589868Ga0214277_105898682F096317VNNQALLLAATASTTEVSGLRQSLGRAEEELDLMKR
Ga0214277_10592226Ga0214277_105922262F020492MRMQASLLASAALTTEVDTLKQNLERSEQELGLAKQQLEEKEGKKYLIEICERCNCKK
Ga0214277_10597619Ga0214277_105976191F034384VNAEFCQNFEEETGRIEPGLDPINSPVKDETAMNLLRLESRIDGVVDYLARLKVAMSRIDPALWPEATLQNDLESLMTRLNGIPDRVQEWKKSSARCGADVALSLVRVHCKEAREEKLAAIQVANTRKHSFQDFMETFIAAATRITDGIDLDEFVAPSNPPPEE
Ga0214277_10603654Ga0214277_106036542F081962LLPEVYLILTNTGPRSTNLKQNMLIKLKAVYTLVEQLYIGSQRALAVVALSNDVPHLLQDVLQRLAVLPQRIQELRWAQARAGAIAALSRAKAWLPELDPADIALGYPSLKEDGTPFDEKDFTTCVRDIRPVATQIGNDTDLTKCQPGYDKENRRIPMPHYDDVSLISPTRKHTIAPEVDPPGLIDDEAEFE
Ga0214277_10605408Ga0214277_106054082F035626MAPTIINNDAVQGETFLPGQIFVFGGFALRANSLGRLEQIESYAPGRQVRFGSLNYTADIRRDLIFDGFVPLPSAPLCHDEHDLALPPNSALEAAPAS
Ga0214277_10606724Ga0214277_106067241F032472PRSAGFDTDIGAFIESSSVSSPIGLMASSTNNAVQGETFLPGQIFVFGGFALRANSLGHLEQIEIYAPGRQVRFGSLNFTADIRGDLIFDGLEPQPSAPHCYDGHDLALPPNSALVAALGSASAISPEPIAQIAGRWIDAALGASTSLAMEPNTNLVPCETRDSEAPDSLPDSEPPAPLPIDPDWAPVMEFTAADIFQHSLFGDILNSLKHLSLSGESWSDYGRDGRDTDDVEIQS
Ga0214277_10610278Ga0214277_106102781F083289MSGYKGTITVHGSRKVALECEEGDAAYAETACATEELKFYQDNVDPADMTSLKKPTTEHDPALKFKSAAETKLVDFTPGD
Ga0214277_10618142Ga0214277_106181421F020828VPPSDQLKQLVELHKVAEEAMKCLIVRLWPGQAMPGSYFGLVRRLVDACPWVEVVKRSAYIEGARRALARTKVHWGKLDAEKLLIDPPPPGKEYRTPEMYYKTVLKGARKIADECPRDVIIE
Ga0214277_10619626Ga0214277_106196261F020828EHPVPFSDQLKQLVELHRLAELAMKDLIVRLWPADPLPRSYFVLVKRLVSACPRLEVIKRSVCIEGARMAFARAKVHWAKMDAEKLMTEGPPKGKEHRHPEKYYDSVLKGSRLVAEQCAKDVIFE
Ga0214277_10624558Ga0214277_106245581F098130MPGPHPRRRPVRDAVLLQRTHVRDWAPSGWHWEVLPGGACRLVRNPTSGPVVDPDLLWWRSRGPHSVQRQPAPPEVVRRRVREEDEHVHRYMAAMDDVRFSTTWRVLWADDRRYDPVMVPSLWVCTARAPGTASGALDSSVVLDLY
Ga0214277_10626106Ga0214277_106261061F079404LPEFSNAPLKKRLSWRPRSPQREDDRSVHYLMGWIRLLAHSGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGENDATRHGRKGPGSTADLVKILSGLYKGEKEDFLRTSPLNGFSMNNPRSWVSGRLYI
Ga0214277_10629734Ga0214277_106297341F035626MAPSIINNDAVQGETFLLGQIFVFGGFALRANSLGHLEQIKSYAPGREVRFGSLNCTGDIRGDLSFNGFEPQPSAPHCHDGHDLALQPDSA
Ga0214277_10634847Ga0214277_106348471F004001LPREVGESLLLQVFKSHGDVALRDVVSGAVVGLDGLSGLFQLY
Ga0214277_10638705Ga0214277_106387051F011632ALEWAAQRGGGVTEPGGVQRAFGRCVEGYGLARTIGEGRMVGLGDPVGLFQP
Ga0214277_10639377Ga0214277_106393771F068298ALEWAAQRGGGVTDPGGVQKAFGCCVEGHGLARTIGDG
Ga0214277_10646093Ga0214277_106460931F001813AAQRGGGVANPGGVQGTFGHCVEGRSLMRTIGDAWMVGLGDPVGLFQPW
Ga0214277_10648528Ga0214277_106485281F032472RSAGFDIDNGAFIENSFVSSLLGLMAPTIIDSDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESCAPGHQVRLGSLNYTADIRGDLIFDGFEPQPGAPHCRDGYDLALPPNSTPEAAPASAPTLSSEPTAPIEDGWLDTASGAVVSTAIEPNTSIILCAAHDSKVSDSFPDSKPSAPLPIESDWAPIMEFTATDIFQHSPFSDILNSLRSLSLSGEPWPDYGQQ
Ga0214277_10649317Ga0214277_106493172F020492MGMQAALLTSTALTAEVNALKESLERSESELGRAKKQLEDEEGT
Ga0214277_10659111Ga0214277_106591112F096317VLLAAAAHTVEVAGLKRDLGRAEEELGLVKRQLEENKGK
Ga0214277_10662905Ga0214277_106629053F014346VVLEKTLESPLDCKEIQPVHPKGNPFWVFIGRTDVEAETPIFGELTHLKRP
Ga0214277_10672931Ga0214277_106729311F001445TFNFHFHALVKEMATLSGVLAFRIPGTGEPGGLLSMGSHKVGHD
Ga0214277_10674175Ga0214277_106741751F035626MASSLDNRDTVRDETFLLGQIFVFGGFALRDDSFGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPQPGAPHCRDGHDLALSSDNTQSITQVSAPTISSESTMP
Ga0214277_10683378Ga0214277_106833781F086390AQATIGSIHIPAIHYFALFIGRCINGKDEACHMCIPDLCVLKSVVSGYKGYNLGVIVARRLQNNSRKGNLFGGIYATRVANYLGITPREGDMFIPPVYLDYEAMVNHQFLARNEQFLQYRLTYDRRNIAHVTHPAPYLFDYQAKGRYVVTREEAAEHERRAEAARQHAAAQEAVAAAS
Ga0214277_10693005Ga0214277_106930051F004001LAQAAQGVAESPSLKVFKTHGGVALKDMVNDHGGGGLMVGLDDLSGLFQPS
Ga0214277_10695653Ga0214277_106956531F105149GGPSRKQGPRLTMRDVDDELPREAHVRACEWSSEDFMDRAGIKEEFNVYVRNADLESFEADKCRQYHYPTDSFVRRFEFSSSSNSQTVLFDLYENSCTMDLEDFTIACKLPQWGSTSEPRKYEFRDFLASITMVKFRDITQATIGSIHFPAIHYFALFIGRCINGKDEACHM
Ga0214277_10697187Ga0214277_106971871F096317VNKQASLLAAAARIAEVSRLKRDLGRAEEELVLVKRQLEENKGIQITPSIY
Ga0214277_10698248Ga0214277_106982481F094706RGKLYTDDAGWGPKAGSIEYRYRVPFGGIHVFIGKIGEPGPEPDTCTDIIETAQRASPSPVQPMAKHVFVGVIHGAEYEDGPASDGETVVCSDDKSSGETELLYQLQDGRIS
Ga0214277_10709901Ga0214277_107099011F020492MRMQASLLASAALTAEVDTLKQNLERSEQELGRAKKQLE
Ga0214277_10711313Ga0214277_107113132F089079MAGTSENGDSTPKDFKECASQEQLQATVEKVQDGMNEAIKKAVTDALIELNVGNSIE
Ga0214277_10711686Ga0214277_107116861F052316WAMVKTRYTKLDPNHMAEVGPVGPDGKEIPVILVYNQVELAAKYSQQDCKLHSLLDGIEEYNQSI
Ga0214277_10715813Ga0214277_107158131F081962VLTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRVQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFDACVKIVRPVATLIANDTDLTKYQPGYDAENQRIPTPRYEAISLVPPTRKHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVMGTAGGAERDEPEASTPQAP
Ga0214277_10716520Ga0214277_107165201F035108MSVGLLTGRPAEEMPGSPGALLPALLQLHERVRQAMQGVVQAMWPSLSLPEGIGELAKKLEGVRQRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPMGPDGKEIPVSFVYG
Ga0214277_10718678Ga0214277_107186781F006329MILELHVADVVDDHKIKMDGMRLKMRKIRKYAIHTEAWYHYAVGSIVTLVAIMIAFVFALKCFT
Ga0214277_10724324Ga0214277_107243241F093003DDNYMPLSGDEASLGDEEFIVPEDPVEQERFKRRLIATANSLKKKQQQLRADQDLLADRWTEVQVAEEYELERPSKSYPMRRLLPQLEEETLKPTSPAYDAADRPPRGRDREAYQPEVQPAPRRHSNKNTKARGNTRDLRDVLENKAKHARSIYGSRGCAPTRDDDRHAGYTKSKSGRAEYRRQESYELRHDIARHSGAAPPRCFTAE
Ga0214277_10729445Ga0214277_107294451F076912LENSTALSNGKGSNADKVQDSETSLLVSQKADKTYLDDSEGTQKSCLDVVFELLATTAGTSSLNSLPESVRLLESQLQVERHRSDVLRQEPEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNKLAKHLDSIMGTQDIVS
Ga0214277_10733794Ga0214277_107337941F011632ALEWAAQGGGGVTNPGGVQVLFGHNLVRTIGDGRMVGLDDPVSLFQP
Ga0214277_10747987Ga0214277_107479871F034384MFGKYFQLWLLPFDYPLDLVITLAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMDIFRLESRVAAVVDYLARLKVATSRIDSTLWPGETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0214277_10749138Ga0214277_107491381F032472FTSIKRARTWVKHRVPCLLLPAALDAQYGTPYPRSAGFDTDIGAFIESSSVSSPLGPMAPSIVNNDAVPGETFLPGQIFVFGGFALRANSLGHLEKIESYAPGHQVRFGGLNYTADIRGDSIFDGFEPQPGMPHCRDGYDLALPPDRALEVAQVSAPTLSSELTAPTEDGWLDTSSGDAISTVITPNTN
Ga0214277_10756725Ga0214277_107567251F011632LEWAAQRGGGVTEPGGAQRAFGCCVEGHGLARTIGEGRIVGLDDPGGLFQPLRFFASI
Ga0214277_10760468Ga0214277_107604681F096317VNKQALLLTAAARTAEVAGLKRELGQAEEELGLVKRYLEENKGK
Ga0214277_10763366Ga0214277_107633661F076748IPTPMRLIQIPGDSPTLYVSKTPFLQSDSSWFDRNDEEAVIFPNWETGIT
Ga0214277_10764048Ga0214277_107640481F059631GLLCGGLKGWQSGWFYITEPCDPKWIAAPEFRSGPPTRLTSWKETGLSWGDEKEVTGLQTCIQSLVSKPIKLVNVVQVMLVRRILPCQQRGFNLWEFDLAQHQTLNRLFDMTYEDVWKVLTKGAEAPTSASEDRRYSSQRHASEVSYFHLLQDVKFFHSLTLCGI
Ga0214277_10768157Ga0214277_107681573F053764EIRLIMFFAAKDGEALYSQQKQYWELTVAQIINFLLPNSDLN
Ga0214277_10769741Ga0214277_107697411F096317VNKQVVLLAAAARTAEVAGLKRDLEQAQGELGLTKRQLEENKGE
Ga0214277_10770686Ga0214277_107706861F096317SLLSAAARTTEVSGLKQSLARTEEELGLVKRQLEESQGI
Ga0214277_10772465Ga0214277_107724652F035108MPGSAGDLLPELLQLHERVRQAMQGVVQALWPSLSMPEGLGELAEKLKGVRQRFRLWKISACHQGAKEAWAMVKTRYMKADPNHMAKVGPAGPDGKEIPMSLVYDQVKLAAKYS
Ga0214277_10779978Ga0214277_107799782F020828AGHPVPPSDQLKQLVELHKAAEQAMKGLIVRLWPGEAMPGSYFGLVRRLVDACPWVEVIKRSACIEGARRALARAKVHWGKLAAEKLITDAPPVGKEYRTPEMYYRTVLKGARKIADECPRDVIIE
Ga0214277_10781260Ga0214277_107812602F020492MGMQAALLTSPALTAEVNALKQSLERSENELGLAEKQLEDKEGK
Ga0214277_10781569Ga0214277_107815691F076912LVSNKADKTAKEDFLEDSETTPKSCLGLVFELLATTTCTSYSNSLSESIRFLESQLQAKRHRSAMLRQEAEGMRKSLENSDAYFLVQQQALEDLSAKLEKVNKLAKLIASMVDT
Ga0214277_10783322Ga0214277_107833223F092835NKPGVRLCVDHQHSQFPPILARFMDYYSRFWGPEAISIVVEPEGALTCRSSTIAVWADFGPFLGLLLYFGVSESFP
Ga0214277_10791428Ga0214277_107914281F028669MYARREIKKQQFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRRAIGKDRKKQELRKA
Ga0214277_10796126Ga0214277_107961261F035626MAPKVINGDAVQGETFLPGQIFVFGGFALRANSLGRLEQIKSYAPGRQVRFGSLNYTADIRGDLIFDGFEPLPSAPHFHDEHDLALPPNSALEDAPTSAPTPSSEPTTPIEDG
Ga0214277_10800847Ga0214277_108008472F096317VSVNKQAVLLAVAARTTEVAGLERDLKQAEEELSLTKRQLEETKGE
Ga0214277_10801767Ga0214277_108017672F053764MVNTKIRWIVFFAAEDGEALYSQQKKGQELTVTQIMNSLLQNSNLN
Ga0214277_10803542Ga0214277_108035421F001813VTDPGGVQGTFGCCVEGHGLVRTIGDGRMVGLDDPVGLFQPW
Ga0214277_10806647Ga0214277_108066471F034384CTEFCQNFEEETSRVETGLDPINSPVKDETTMNVLRLESRVAGVVDYLARLKVAVSRINTTLWPRETLQLDLESLMTRLNEVPGRVQEWKRSSARCGADVALSLVCVHCKEAREEKLASIKVANTKKHDFQSFMETFIAAATRIVDGIKLDEFVEPASPPPVE
Ga0214277_10810597Ga0214277_108105971F001445LEKEMATRTSVLAWSVLAWRITGTGEPGGLLSVGSHRIGHD
Ga0214277_10810880Ga0214277_108108801F005658MAWVEKDHNDHRVSTPCYVQGRQPSDQAAQSHIQPGLECLQGWGIYFCDK
Ga0214277_10814753Ga0214277_108147531F034384MNLLRLESHIDGVVDYLARLKVAPSRIDTALWPGATLQNDLKSLMTRLNEIPGRVQEWKKSSARCGADVALSLVRVHCKDAREDKLASLKVANTKKHDFQSFLETFIAAATRIADGIDLDEFVAPSSPPPEE
Ga0214277_10816855Ga0214277_108168552F083289MPGHNGTITVHGSRKVALECEEGDAAYAESVCATEELKFYKDNVDPTDMTSLKKPTTENELAMKFKSADETKLVDFVPGDSSQQFSISANLDPK
Ga0214277_10820124Ga0214277_108201241F027342KAFYMQSKHVKVIYRLLTQIRSSSGAFADLPRSVSDAAQFYQAEDGSLTEKLFWSQYAEAEHPVPMSDQLKQMAELHKAADQAMKGFIVRLWPGDALPNSFFGLVRRLVDACPRLEVVKRSVCIEGARRAFARVKLQWVKLDAVKLIKEGPPEGKEHRHPEMYYEGVLPGARLIKDECSKDVIFE
Ga0214277_10824901Ga0214277_108249011F059631MVDKMPNVTWLEGSFIESIKGWHSGWFYITEPRDPDWAAAPEFRSGIPTQLTSWKESGRIWGDSEELTVLQACIQKLVDKKLKLVNIVQVMLFRRILPCQQRDFNLWEFDPAQHQTLSELFDTTHEDAWKVLFKGAEVPPPLTEDRGFSAKHQASAVSRFTFYRA
Ga0214277_10832458Ga0214277_108324581F059631VLWLKGSFVETLKGWQSGWFYITEPRDPEWVAAPAFRSGPPTRLTSWKETGLSWGKKGELTRLQTCIQTLVDKKLKLVNVLQVMLIRLILPCQRRAFNLWEFDPAQHRTLNRLFDTMYEDAWRMLFKGVEAPASASEDRGYSSQRHASKVCYLDLLQDAQAFFIV
Ga0214277_10833914Ga0214277_108339142F038012MIIQFQPNCYVQGCQPLDQAAQSHIQPGLECIQKWGIYNLLGQ
Ga0214277_10835106Ga0214277_108351061F001813VQGMFGCCVEGHGLVRTIGDGCVVGLGDPVGLFQP
Ga0214277_10836935Ga0214277_108369351F052316MVKTRYTKADPNHMAEVGLAGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSI
Ga0214277_10841797Ga0214277_108417971F034384VETGLDPINSPVMDETAMNVLRLESRVAAVVNYLARLKAATSRIDTSLWPEETLQNDLESLMTRLNEVPSRVQEWKKSSARCGADVALSLVRVHCKEAREDKLVSLKVANTRKHDFRSFMETFIAAATRIAAGIDLDKFVAPSSPPQEG
Ga0214277_10847610Ga0214277_108476102F094706MGPAHDGFEFLKGNFEGLKGYVVGQMTKSRRGKIYIDDKGWGPDAGSIEYGYRVPFGGIHVFISRIGEPGPEPDNCTDLVEMAQRARKARVQPVMKRAFVGYIHGEELSEGSEDGGETTVRSGDGSSAGSTDSLYQVQDGVPRGCSNGTSIP
Ga0214277_10848376Ga0214277_108483761F009131LRASKKRCYEKSIECVKKIRTSFASVGAFSSEENFVKGDPEGPIEWINHEAEAFEEILNSRGDICAFSGARGIATILERKGCEHIKILAQSEATLSFEDAKDPSAEASMVGGKFFTDVWDNGGREMAREIIQKSEKGIHDARKVAEAAEKSVEPEGQIGIN
Ga0214277_10850237Ga0214277_108502371F027342TALESAKAANAEAYKALQEIAAVKKIAAGKAFFMQSKHVSVNYLSLTRIRSSPGAFVDLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLIVWLWPKEAMPGSYFGLVRRLVDACSWVEVIKHSACIEGARWALARAKVHWGKMDAQKLVTDPP
Ga0214277_10858334Ga0214277_108583341F035108MSVGLLTGHPAEEMPGSTGDLLPELLQLHERVRQAMQGVVQAMWPSLSVPEGLGELAEKLEGVRQRFRLWKISAYRQGARAAWAMVKTRYTKADPNHMAEVGPLGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYTESI
Ga0214277_10870742Ga0214277_108707421F076748MRFFQFPGDSPPIYVTKSSFLQSESAWFDRNDEDAVLFPNWETRITSFESGI
Ga0214277_10877318Ga0214277_108773181F038003RQRRRRRGRQGQVGGRASSAVEQIDAPDTPTEGTPDVDLAFKTEASAVPPRHADPEQEDDAGALAESLQDVALEPEMTVQPVPDVTTSLLVDQKVLTNSHLTSFRLGLNPPSNLALAGALIEASATPLGFRMRSPWDRLTDVSTYGPSGSEEDDDPSIGWDFSGLDNPSAVRDFMTACDYCLSDCSDGSRSLGDESCGPSRECFHIELGDPSEGNHLGMPEDGDLPRPAPRADIPRELAVVPAPAGGYDPQLEQVREVQARLNEGTGALEPIRRDVGQAWVGQPLAGEIRHLPQGLQHR
Ga0214277_10878628Ga0214277_108786281F020828VPLSDQLKQLVEIHKVAEQAMKGLIVRLWPGEVMPGSYFGLVRWLADACPRLEVIKRSICIEGARRALARVKVHWGKMDAEKLVTDRPPEGKEHSEPEMYYEGVLKGARRIADECSKDVIFE
Ga0214277_10879985Ga0214277_108799854F098130MPGPHPRRRPIRDDVRLTHVRDWAPPGWHWEVLPSGARRLVRNPAPGPVVDPHLLWWRSRGPLSVRREPAPPEVVRRRVREEDEHVHRYMAAMDVRFSNTWQVLWGDHPSYDPVMVPSLWLSTA
Ga0214277_10882681Ga0214277_108826811F035108EEMPVSTGDQLPELLQLLERIRQAMSGVVHALWPALSLPEGLGELVEKLQGVRQRFRLWKISACRQGAREAWAMGMTRYKKADPNHMAEVGTVGPDVKEIPVSLVYSQVELAAKFSQRDCKLDSLLDGIEEEYNQ
Ga0214277_10889060Ga0214277_108890601F032472MASSLVNRDAVRDETFLPGQIFVFGGFALRADSFGHLEQIESYAPGHQVRFGSLNYTGDIRGDLILDGFEPQPSAPHCHDGHDLALSSDNAQSVAQGSAPTISSEPTTPVGDGRLDTTPETAISMAIEPYTSLVPRNAHDSKVPDFDPDSVNPAPLPIKPDW
Ga0214277_10889327Ga0214277_108893271F011632VLEWAAQRGGRVTDRGGVQRVFGCCVEGHGLARTIGEGQMVGLDDPVGFFQP
Ga0214277_10890629Ga0214277_108906291F028669MYGRREIKKQRFKCWSDQFITNVNKGVEEREGRALLRIGVMGKGRRAIEKIVRGKNCVKR
Ga0214277_10890643Ga0214277_108906431F020828LSDQLKQLVELHKVAEQAMKGLIVRLWPNEAIPGSYFGLVRRPVDACPWVEVIKHSGSIEGARRALAHAKVQWGKMDAEKLVPDAPPPGKGYRTPEMYYKSVLK
Ga0214277_10893714Ga0214277_108937142F052316MVKTRYTKLDSNIMARVGPRGSDGQEILVSLVYDQVKIAAKFSQQDCKLD
Ga0214277_10894476Ga0214277_108944761F034384VVLPRSCSLCLKVNLYAQQSFSTVIFPFDHCLDSVIALAEFCQDFEEETSRLEPNLDPVNSPVNDEVAMNVFRLESRVAAVVDYLARLKVATSRIDSTLWPGETLQNDLESLMARLNTVPGRVQEWKKSSARCGADVALCLARVHCKDAREDKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0214277_10898512Ga0214277_108985122F086390MDLEDFTTACKLPQWGSASEPRKSEFRNFLASITMGESRDIAQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLSILRSAVLGDKSYNLGAIIARRSHNNRFSGDFFGGIYATRLANFLGVPIRGYDIELPPIYLDYEAMVRHQFVERNDQSLQYRLIFDRRHTYHVALPAPTFFDFQAKGRYVITRDEANEYERRTEAARL
Ga0214277_10900025Ga0214277_109000252F034384VISDGCLESVVVLAEFCQNFEEETGRLEINLDPINSLVKDEVAMNVLRLESRVAVVIDYLARLKVATSRIDTTLWPRETLQNDLESLMTQLNKVPSRVQEWKKSSARCSADVALSLVRVHYKDARENKLVALRVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEG
Ga0214277_10902186Ga0214277_109021861F020492MGLQAVLLTSAALTAEVNTLKQSLEQSENELGRAKKQLEDKEGE
Ga0214277_10906334Ga0214277_109063343F001813FMRMLRFGRCVEGHGLMRTIGDGWTFGLDDPVGLFQLW
Ga0214277_10907061Ga0214277_109070612F079404SGTLKKASEEWPSECFYMEDAPLPDPVRIGLPEFNNAPLKKRLSWRPRSPQLEEDKSVHYLMGRIRLLAHSGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGEDDATHHGRKRPDSAEDVVKILSGLYKGEKEDFLQTNPLNGFSMNNPRRWVSEHFKGPTHAFKV
Ga0214277_10910089Ga0214277_109100892F020828SDQLKQLVELHKAAEQAMKRLIVRLWPGGALLGSYFGLVWRLVEACPRLEVIKRSVCIEGARRALARAKVHWGKLDAEKLVKDGPPPGKEHRKPEMYYEGVLKGARLMADECSRDVIFE
Ga0214277_10920095Ga0214277_109200951F014346VVLEKTLESLLDSKEIQPVHPKGKESRIFIGRTDAEAETPVLWPPDAKN
Ga0214277_10932665Ga0214277_109326651F027342EETFLLLTRIRSSPWAFTDLPCSISDATEFYRAEEGSSTEKLFWSQYSRAEHSIPLSDQLKQLVELHRAAELAMKDLIVRMWPGEPLPDSYFGLIKRMVSACPWLEVIKRFVCIEGARRAFARAKVHWARLDAEKLVKDGPAEGKEHRCPEKYYDGVMKGARLVADECTRNLIFE
Ga0214277_10933330Ga0214277_109333301F086390TMGESRDITQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLSVLRSAVLGDKHYNLGAIVAHRLHNNKINGDFFGGIYATRLANFLEVPIREYDVELPNVYLDYNAMVHHRFLERNEQSLQYRLIFDRRRAVHITLPAPAFFDYQAKGRYVITREEADEYERRAEAARRHAAAQEAIAAASQYDPGYNYGYPPGHPWQ
Ga0214277_10936864Ga0214277_109368642F020492MGMQATLLTSAALTTEVDALKQSLERSENELGRAKKQLEDKEGK
Ga0214277_10942422Ga0214277_109424221F035626MAPLIINNDTVQGETFLPVQIFVFGGFALWANSLGHLEQIESYAPGHQVRFGSLNYMADIRGDLIFDGFEPQPSAPHCLDGHDIALPPNSALDAAYASVSTIDSEHTVPIE
Ga0214277_10942885Ga0214277_109428852F079404GSMYQVGGAEVWRIAGTGYLSGTPKKASEDWPSEWLYIEDFPLPDPVRIGLPEFDSAPLKKCLSWHPRSPQRESDRDVIYLMGRIRLLAHSGLTMIGVMAACIMRGVQPLQYRGHPMWDFNGEDDATRYGRKGPDSAAALTKTLSALYKGEEEEFLHVNPQGGFSMYNPPSWVSGHIYLPIHFIFPLLNILSNDFNAGNAPGC
Ga0214277_10943178Ga0214277_109431781F105149MFRKMYQGGSSRKQGSRPAIREPDNELPRDAQVRPCESPSEDYMVRAGIKEEFEAYVRDADLESFVADKCSQYYFLSDSFVRRFKFTSLRISQTVLFDLYGKSYTMDLEDFNIACKLP
Ga0214277_10944435Ga0214277_109444351F003406RKRWPGEWMKEWFYVKNDLKVREDIKDVIMCPIWQRFGLRKSKVEMDEVAEECQRAFDVVCSFIGTRDLIQEHIAFRVWPLADNWEMPKETVKETDEGGLVRLKYTFKYGDKFVEPDDDWLKSIETVSDELLGAYSKAEDTAMSAAFGGQRKKRLNRVFDAIGFVYPDYHYPVRGQKRK
Ga0214277_10945644Ga0214277_109456441F083289KMPGHNGTITVHGSRKVALECEEGDAYAESVSATEELKFYKDNVDPADMTSLKKPTTEHDPALKFKSADETKLVDFVPGDSSKQFSISANLDPK
Ga0214277_10951847Ga0214277_109518472F020492MSIWDLQAALLTSAALTAEVNTLKQSLERSESELGRAKKQLEDKEGE
Ga0214277_10952151Ga0214277_109521511F038012MIISFQPPCYVQGRQPLDQAAQSHIQLALECLQGWGIYNLLRQPVPAYH
Ga0214277_10955642Ga0214277_109556421F094706VTNPRQLAPTVGLSHDGFEFLKRNFEGLKGYAVGRKTKSRRGKLYIDNAGWGPEAGSIEYGYRVPFGSIHVFIGKIGEPGPEPDICTDLVETAQRARSARVKPVMKRAFVGVIHGGESEDRSESGGETVVYSGDESSTGETESLYQLQDGRIGGCSDGDSIPDSHEPPSWAAIFMDCTQQVVNSLTTAAL
Ga0214277_10959902Ga0214277_109599021F033854MVAEGQSDTVASDMEVCMKQRCVTGFLHAEKFAATDTHQCLLNVYGGQTVDESTVRQWVEIGRA
Ga0214277_10977308Ga0214277_109773082F004001VESLSLEVFKNRVDVTLRDVVGEHGGDEWMVGRDDLSGLSQP
Ga0214277_10981155Ga0214277_109811551F018877MAQEIIQKSEKGIHDARKVAEAAEKSTEPEGQIGINLWFLLCCNF
Ga0214277_10985024Ga0214277_109850241F081962VVTKLKAVYTLVEQLYPGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATLIGNDTDLTKYQPGYNAENQRIPTPRYEALNLIPPARQHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVLGSAGGEDRNEPETSTQQAS
Ga0214277_10985255Ga0214277_109852558F065281MAKKSIITSLRLNEDDYLKLKALKEEYGISWTKLVAYINEILEQDMKEKKEK
Ga0214277_10985989Ga0214277_109859891F032472FDTDYGAFIESSTETLSKVLMAPSTIYNDAVHGEVFLPGQIFVFGGFALRANSFGHLEQIESYAPGHLVRFGSLNYTADIRGDLIFDGFGPRPGAPHCLDGHDLALPPDSDQSAAQAFTPTISSEPTALARDGRFAAAPGAAISAAIEPNTSLVLCKASDSKVPDSVPDSEYSAPPSIE
Ga0214277_10995402Ga0214277_109954021F094706ALTPSSFLVAMAPRLSPSSRASAVTIPRQLAPTVGPAHGGFEFLKGSFEGLKGYAVGRMTKSRRGKLYIDDANWGPDAGSIEYGYRVPFGGIHVFIGKIGEPGPEPDLCANFIETAQRARPARALPALKHAFMGCIHGGPYDLSGSGDEAAAGSDGESATDESNSLYQLQDGKLMGCSEGDSIPDLFEPPSQVGGFMAGAQ
Ga0214277_10997969Ga0214277_109979691F002002MVKPLSTMRETQVRALGWEDPLEKEMAIHSSTIAWKIPWTEEPGRLQSMGLQRVGHD
Ga0214277_10998317Ga0214277_109983171F027342LERDSKTQRSELAKALENAQNAKAEAQKALQEIEAVKKIAAGKAFIMQSKHVKETFLLLTRVRSSPGAFADLPRSVLDAAEFYRAEEGSSTEKLFWSQYTGTEHPMPLSDQLKQLVELHKAAEQAMKGLIVRMWPGEPLPDSYFGLVRRLVNACPWLEVIKRSVCIEGARRAFARAKVHWAKLDAEKLVKEGPPEGKEHRHPERYYDSVLKGARLVAEECAKDVIFE
Ga0214277_10998645Ga0214277_109986451F034384KLTNSWIVNAEFCQNFEEETGRIEPGLDPINSPMKDETAMNLLRLESRIDDAVDYLARLKVAMSPIDPALWPEAVLQNDPESVMLRLDEIPDRAQEWKKSSARCGADVALSLVRVHCKEVRQYKLAAIKGANTQKHDFRTFMETFIAAATRIADGVDLDEFVEPASPPPAK
Ga0214277_11005971Ga0214277_110059712F003406MTEWFYVKNDLKAREDIKGIIMRPIWQSFGLRRPKVEMNEAAEECQRAFGVICSFIGTRDLVQEHIAFRVWPLAEKWEMPQETIKEADEGGLIRLKYTFKFGDKFVEPDDDWLKSIENLSDELLGAYSKAEDTAMSAAFGGRKKKRLNRVFDAIGFVYPDYCYPIRRQKRKNT
Ga0214277_11006539Ga0214277_110065392F004815RARLDVAVGSLVSWLVTLHIAGAVETRWSFSTQVVLFNPGHSMIL
Ga0214277_11015933Ga0214277_110159331F038012MIIEFQPPYYVQGHQPLVQAAQSHIQPGVECLQGWGIHNLLGQPVPVSDHQVQ
Ga0214277_11017582Ga0214277_110175821F032472IRLDAQFGTPYPRSAGFDTDIGAFIESSSVLSPSGPMARTIINGDIVQGEAFLPRQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPQPSMPHCLVGHDLAVPPNSTLEAANAPALTPNSEPAAPIEGERLDVTSGAVISKAIKPNASPALCTARDSKEPDSSPNSEPLTSLSIEPDWVPIMEFTAADIFQQSPFGDILNSLKSLSLSGEPWPDYGQQGWDTDDEEI
Ga0214277_11021288Ga0214277_110212881F096317VNVNKQVVLLASAIHTAEIAGLKRDLEQAQGELNLTKRQLEESKGE
Ga0214277_11022811Ga0214277_110228111F035626MAPPIINSDAVQRETFLPGQIFVFGGFALRANSLGHLEQIDSYAPGHQVRFGSLNYTADIREDLIFDGSKPMTGAPYSHDEHDLGLPSDSVQESAPAAAPALNPEQTVPSEDGWI
Ga0214277_11026564Ga0214277_110265641F076748MRFIQLPGDSPKLYVSKSSFKQSDSSWFDWNDEEAVLFPNWETGIT
Ga0214277_11033237Ga0214277_110332372F001813VTKPGGVQRAFGRVEGHGLVRTLGEGRMVGLDDPVCLF
Ga0214277_11039361Ga0214277_110393611F086390ITQATIGSIHFPAIHYFALFIGRCINAKDEACHMCVPDLSILRSAVLGDQSYHMGAIVARRLHQNRHSEDFFGGIYATRLANFLEIDIREGDMELPPSYLDFDSMVSHQFVERTVPPLQYRLIFNKWHVVHITLPAPAFFDSQTKGIYIITKEEADEYEGRAEVTRRHAAA
Ga0214277_11051201Ga0214277_110512011F028669MYIRREIKKQWFKCCYDHFISNVNKGVEERGGRTLLWIGVMGKGRRAVEKIE
Ga0214277_11051850Ga0214277_110518501F046965LRLEIENEKLIAKAKDLNVCNISISNLRDENAILHAKVDELNACKPSTSTVSHVSICTRCKDVNVDAIHDHIAMIKQQNDHIAKLDAKIVEHELENKKFKFARSMLYSGRRPGIKDGIGFQKGDNVKLNAPPKRLSNFVKGKAPMPQDNEGYILYPAGYPESKIRRIHS
Ga0214277_11055439Ga0214277_110554392F006329EGEKMELELHVADVVDDHKIKMEKMRLKIRKIRKYAIDSEAWYHYAVGSIVTLVAILIAFVVAFKFFS
Ga0214277_11055959Ga0214277_110559591F020289MLGKLKAGEKGMTEDEMVGWHHRLDGHKFGEASGVGDGQGGLMCCSPWVCKELDTTE
Ga0214277_11062394Ga0214277_110623941F001813GVTDPGRVQRTFECCAEGHGLARTIGDGQMVGLDDPVGLFQP
Ga0214277_11067257Ga0214277_110672571F086390QATIGSIPFPAIHYFALFIGRCINGKDEACHMCVPDLSVLKSAMLGDRQYNLVAIIARRLHNNCLIGDLFGGIYATRVANFLEIPIHENDMELPPAYLDYNVMVRHQFIERNEQPLQYRLMFDRRRTVHVALPAPTFFDFQAKGRYIITREEANKYERRAKAARLQDATRD
Ga0214277_11070022Ga0214277_110700221F020492MRMQASLLATATLTAEVGTLKQGLERSEQELGHAKRQLEEKDGKKYLIKRCL
Ga0214277_11072722Ga0214277_110727221F032472ARTWVKQSVPSLLLPSGLDSQFGAPYPRSAGFDTDIGAFIESSSMSSPIGSMATSIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPQPSAPHCLDGHDIALPPNSALEAAHASVPTIDSEPTAPIEDQRLDAASGAAISEAIEPNSSPALRMARDSEEPDSSPNSKPPAPLPIESGWAPIMEFTAADIFQHSPFSDILNSLKSLSLSG
Ga0214277_11073247Ga0214277_110732471F096850PKKAAATLETTEISDSKAPSQETETEAGPSEPAKIKPLESETEKITKPTLVEETGVIAPEASPKVRDYIVRHASGKKLSEKEEQEAQHYAQKLKYPKGALIFNGSGEEDFLYCLPDSKEISVCREMSKSFGFPTLEDGLSVLSKNDLADSLAYNSLKVRYMRSLYFSVRLNPLTHTHISFCRA
Ga0214277_11078016Ga0214277_110780162F059631MARGLLCGDPEGVAIEWFYITEPRDPEWVAAPEFRSGPPTRLTSWKETGLSWGSKGEVTGLQTCIQTLVDKQLKLVNVVQVMLIRLILPCQQRAFNLWEFNPAQHRTLSRLFDTTYEDAWKVLFKGAEAPASATEDHGFSMQRHASVVSCLYLLQGISFS
Ga0214277_11086272Ga0214277_110862721F020828IVRLSPKDAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARTKVHWGKMDAQKLVTDPPPEGKEHRTPEMYYRSVLKGARIIAGECSKEEIFGRLAFCYPVR
Ga0214277_11099248Ga0214277_110992481F096317VNKQASLLAAAAATAEVSGLRQNLRRAEEELGLVKRQLKENKGK
Ga0214277_11100015Ga0214277_111000151F092835LRVGRQHSPFWPILARLLDYYSLFWGPRVISTIDEPWGAFACRSSTLAVLADSVPFRDYYLVLGPRSGFHN
Ga0214277_11105012Ga0214277_111050121F067310EIPGRVQEWKQSFARCGADVALSLVRDHCKEAREENLAAINLANTKRHEFQSFMETFIAAATRIADGIHLDEFVEPASPPPTE
Ga0214277_11105428Ga0214277_111054281F027342PGAFADLPHSISDAMEFYPAEEGSSTEKMFWSQYIGAEQPMPLSNQLKQLVELHKAAELAMKDLIVRMWPGEPLPGSYFGLVKWMAHACPRLEVIKQSVCIEGARRAFACAKMHWGKLDAETLVKDGPPKGKEHRYPEMYYDGVMKGAQLVANECPKNIIFD
Ga0214277_11107948Ga0214277_111079482F035626GAFIESTSVSSLQGLMASSVVNNTVQGETFLPGQIFVFGGFVLRANSLGRLEQVNSYAPGHQVRFGSLNYVADIRGDSIFKGFETAAIAPLLSDEHDVNLSS
Ga0214277_11111982Ga0214277_111119821F020828VPLSDQLKQMVELHKVAEQAIKGLLVRLWPGEALLGSYFGLVRRLVDACPRLEVIKRSICIKGARRALVRAKVHWGKMDAEKLVKDGPPPGKEHRIPEAYYEGVLKGARLIADECSKDVIFE
Ga0214277_11112415Ga0214277_111124151F002471MLKFARDAYTIGRHPSIKDGLGFKREVKNLTSHKASISAKEKGKAPMANSVQKNHAFIYSDRKFSRNSYRNYSDDSYAMPASSSSIVHDRNLARRNVINHIPRRNVVHVSRKIINEPSTIYHAWNASFAICRKDKKVIARKLGEKCKGDKTCIWIPKDIVTNLVGPNKSWVPKTQA
Ga0214277_11115761Ga0214277_111157611F032472LMAPTIIDSDVVRGETFLPGQIFVFGGCVLRANSLGHLEQIESYAPGRQVRFGSLNYTANIRGDLIFDGFEPQPSVPHCHDKHDLALQPDSTPKAAPASAPTFSSEPTSPVEDGWLDTALGAAVSMAIEPNTILTLCAARESKVPDSFPDSEPSAPLSIESD
Ga0214277_11116825Ga0214277_111168251F005658MSWVEKDLKDHLISPPCYVQGHQPLDQAPQSYIQPG
Ga0214277_11130072Ga0214277_111300721F028669MYVQREIKKQWFKCWSDQFITNVNKVDEERGGWTLLWIRVMGKGRRAIEKIERSKNC
Ga0214277_11132636Ga0214277_111326362F020492MGMQAALLTSAALTAEVNALKESLERSENELGRAKKQLEDKEGM
Ga0214277_11135564Ga0214277_111355642F006329LELYVADVIDEHKMKMNAMRLKMDAMRLKIKKIRKYSIDNEAWYHYAVGSIVTLVAIFIAFVVMRVSFL
Ga0214277_11135818Ga0214277_111358181F038003ASTLAKGLLGVTVVPETTVQSVPDVTSSPPIDQEVPTDSHLVPFGFSFDPPSDLASVEAFIEACTNLPGYHMRSPLYRLTAVSTYGPSGSEEDDEPDFCWDFSGLGNPSAMRDFMTACDYCLSDCSDGGRSLDNEDCGPSRECFHVELGDPSEGNHLGMPEDGDLPRPVPRADIPRELAVVPVPAGGHDP
Ga0214277_11151930Ga0214277_111519301F105149MYQGGSSRKKGPRVVINELDDKPPMEADVRPCERPSEPFMVAAGIKDEFDAYVRNADLEEFMQDKCPQYQYLTNSFVRRFKFTSSRNSQNVLFDIY
Ga0214277_11153962Ga0214277_111539621F076748MPTPMTFIQLPGDSPQLFVSKSSFSQSYSTWFDWNDEEAVLFPNWETGIT
Ga0214277_11153962Ga0214277_111539622F076748MPTPMRFIQLPGDSPPLYESKSRFSQSDSSWFDWKDEEAVLLPNWETGIT
Ga0214277_11155223Ga0214277_111552231F004001LEVLKSRVDVALRDAGSGHGGNWLAVGLGDLRGLFQS
Ga0214277_11159037Ga0214277_111590371F094706RQLAPTVGPMHGGFEFLKGSFEGFKGYAVGRITKSHRGNLYIDDVGWGPEAGSIEYGYRVPFVRIHVFISKIGEPGPEPDICPDIIETAQRARPTRFQPTVKRAFVGFIHGDDLEGSVSCGETAIYSDGESSTGETNSMYQLQDGRLGGCSDGDSIPDPYETPNRVAIFMVGT
Ga0214277_11163493Ga0214277_111634931F035108VSLGVLTGRPAEEMPGSTGDQLLKLVQLLEHVRQAMSGVVQALWPSVSLPEGLGGLAEKLQGVRRRLRLWKISACRQGAREAWAMVKTRYPKADPNHMAEVGPVGPDGKEIPVSLMYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSV
Ga0214277_11164832Ga0214277_111648321F099086LFAICNSNVVVSCLTSDPAKTSSGPQPKGDDKIKKMAEDIMDEVVNRLLNEAAEVVLRED
Ga0214277_11164832Ga0214277_111648322F014592WIDHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEAALSFEDARDPSAEASIIGGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAAEKSAEAEGQLGIN
Ga0214277_11172261Ga0214277_111722611F094706MGPAYSAFEFLKGSFEGIKGYAVGRMTKSHRGKLYINDAGWGPEAGSIEYGYRVPFGGIHVFIGKIGEPGPEPDICTDLVETAQRARSTRVKPAMKRAFVGVIHGGSYEDRSEFRGATVVCSGDESSTGETESLYQLQDGRIGSCSDGDSIPDPSDLPNRVGIFMAGTQAALHSSIAAATISGSAGATAAGVGGPVRPPAQ
Ga0214277_11172296Ga0214277_111722961F046965DVITNLRNENASLIAKVDSNICDASIPNLRDNNVELLAKIEELNVSLASLRNENEKLIAKAKDLDVCNVTISDLRDNNDILRAKIVELNACKPSTSTIEHVTICTRCRDVNIDAIHDHMALIKQQNDHIAKLDAKIAEHNLENEKFKFARSMLYNGRRPGIKDGIGFQRGDNIKLNAPPKNLSNFVKGKAPMPQDNEGYTLYPAGYPESKIRKIHSRKS
Ga0214277_11174136Ga0214277_111741361F067310ARLNTVPGRVQEWKKSSARCGADVALCLARVHCKDAREDKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSIPPQEG
Ga0214277_11174293Ga0214277_111742931F011632MNNNSQVKGGQALEWAAQRGGGVTEPVGVQRAFGGCVEGHGLARTIGEEQMVGLYDPVGLFQP
Ga0214277_11174441Ga0214277_111744411F027342EALELDSKTRESELATALESTKSAKDEAQKALQEIDAVKQIAAGKAFYMQSKHVKVNYLLLTQIRSSPGAFADLPRSMSDATQFYQDEEGRSTEKLFWSQYTGTEHPMPLSDQLKQLVELHKAAEQAIKGLIVRLWPSDALPNSYFGLVRWLVDACPWLEAVKRSVCIEGAHRAFAHAKVHWAKMDAEKLVKEGPPQGKEHRHPENVLWGCPEGWSSCGGQVCEGCNF
Ga0214277_11179449Ga0214277_111794491F002994NENANLLAKVDSNVSDVSIPNLRNDNNDLLAKIEELNMSLASLRIENEKLLAKAKDFDVCNATISNLRTKNDMLQAKVVELKSCKPSTSIIEHVSICTRCRDVNIDAIHDHMALIKQQNDHIAKLDAKIAEHNLENENFKFARSMLYNGRRPGIKDGIGFQRGNNVKL
Ga0214277_11187367Ga0214277_111873671F014346MGQLSLLAMHLESPLDCKEIQLAHPKGDESWVFIGRTDVEAETPILGPPDVKS
Ga0214277_11189143Ga0214277_111891432F034384VSKEFCQNFEEEAGLDPINSPVKDEASMNMLRLESRVAAVVDYLARLKAATSCIDTSLWPEETLQNDLESLMTRLNEVPSRVQEWKKSSARCGADVALSLVRVHCREAREDKLVSLKVANTRKHDFRSFMETFIAAATRIGDGIDLDEFVAPSSPPQ
Ga0214277_11194959Ga0214277_111949591F034384SLVKDETAMNVLRLEYRAAAIVDYLARLKVATSRIATTLWPGETLQNDLESLMTRLNEVPSRVQEWKKSSARCGADVALSLARVHCKEAREDKLAALKVANTKKHDFRSFMETFIAAATQIADGIDLDEFVAPSSPPQEG
Ga0214277_11205083Ga0214277_112050832F035108MLIGRPAEEMPGSTGDLLPELSQLHEQVRQAMRGVAQALWPSHSMPEGLGELAEKLKGARRRFRLWKISACRQGAREAWAMVKTGYTKSDPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSE
Ga0214277_11206481Ga0214277_112064811F067310SARCGSDVALPLVRIHCKEAKEEKLAALKVANTKKLDFQSFMETFIEPATRIVDGIDLDEFVEPASPPPAE
Ga0214277_11229436Ga0214277_112294361F067310IPDRVQEWKKPVARCGADVALSLVRVHCKEVRQDKLAAIKVANTQKHDFRTFMETFIAAATRIADGVDLDEFVEPASPPPAE
Ga0214277_11229892Ga0214277_112298921F105149MFRKMHQGGSTRNQGPRPTIREPDNELPREAQVRPCEWPSKDFMIRAGIKEEFDAYMRNADLESFEADKCRQYHYLTNSFVRRFEFSSSRNSQTVLFDLYENSYTMDLEDFTFACKLPQWGSASDPRKSEFRNFLA
Ga0214277_11235513Ga0214277_112355132F020492MHMQASLLASATLTVEVDTLKQNLEQFEQELGRAKKQLKDNEGKKYLVFKYI
Ga0214277_11239240Ga0214277_112392402F052316VKTRYTKLDPNHMAQVGALGSNGEEIPVSLVYDQVEVAAKYSQQDCKLDRLLEGIEEEVFESK
Ga0214277_11247178Ga0214277_112471781F035626MAPSIIGNDAIQDEVFLLRQIFVFGSFILRANSLGHLEQIKRYAPGHQVRFGRLNYTADIRRDLIFDGFEPLPCAPHGHDEYDLALPSDSVQEIAPA
Ga0214277_11248352Ga0214277_112483521F052316MVKTRYKKADPNHMAEVGPVGPDGREIPVSLVYSQVELAAKFSQQDCKLDSLLDGIEEEYIQ
Ga0214277_11256156Ga0214277_112561561F081962MLTKLKAVYTLVEQLYTGSQRALAVVALTNEVPTHLVDVLRRLAVLPQCFQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFATCVKIVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAISLVPPTRKHTFAPEIDPAGLIDEEAQFEA
Ga0214277_11256416Ga0214277_112564162F052316MVKMRYTNVDPNHMALVRPVRSYGKEIPVSLVYDQLKLAAKYSQQDCRLDSLLDGIEEEFSQSK
Ga0214277_11264866Ga0214277_112648661F035626VSLPLGPMAPSIIKNDAVQGETFLPGQIFVFGGFALRANLLGHLEQIESYAPGHQVRFGSLNYTADLCGDLIFDGFEPQPSVPHCLDGHDIALPPNSALEAAHTSVPTIDLEPTAPIEDQRLDSASRAAILEVIEPN
Ga0214277_11265047Ga0214277_112650471F105149MRDANDEPPRDALVRPCEWPSEDFMDRAGIKEEFNAYLRNADLVSFEADKCRQYHYLTSTFVRRFEFSSSRNSPTVLFDLYENSYTMDLEDFTTACKLPQWGSTSEPRKSEFRDFLASITVGESRDITQATIGSINFPTIHYFALFIGRCINGKDEACHMC
Ga0214277_11268160Ga0214277_112681601F034384VKDEAAMNVLRLESFVAGVIDYLARLKVAVSRIDTTLWPRATVPNDLESLMTRLNGIPSRVQDWKKSSARCGADVALSLVRVQCKETREDKLTAIKVANTKRHDFQSFMETFIAAATRIADGIDLDEFVDPASPPPAE
Ga0214277_11270375Ga0214277_112703751F034384VEPGLDPANSLVKDEAAMNVLRLESRIASVVDYLARLKVAMSRIDTSLWPGTTLQNDLESLMARLNEVPGRVAEWKKSSARCGADVALSLVRVHCKEAREEKRAAIQVANTRKHNFQDFMEAFIAAATRIADGIDLDEFVSPSSPPSEE
Ga0214277_11271839Ga0214277_112718392F067310LITRLNKIPDRVQEWKKSSARCHADVALSLVRVHCKEVRQDKLAAIKVANTQKHDFRSFMKTFIAAATRIADGVDLDEFIEPASPSPAE
Ga0214277_11272136Ga0214277_112721361F035626MALSNIGSDAVQGEVFLPGLIFVFGGFALWANSLGHLEQIDSYAPCHQVRFGNLNYTVDIRGDLIFDGFEPMPGASDSHDEHGLDLLSENTRDIAPA
Ga0214277_11272352Ga0214277_112723521F086390IGRCINGKDEACHMCVPDLNVLRSAVLGDKHYNLGAIVARRLHNNKIYGDLFGGIYATRLANFLDIPIRDYDMELPPSYIDFNAMVHHQFVERNEPPLQYRLIFDRRHAVNIVLPAPAFFDFQGKGRHYITREEAEEYKRRAEIARLQAAAHDAIAAASQYDPSYNFGYPPGQP
Ga0214277_11273241Ga0214277_112732412F012765MEELDNHRYKLQESLDDVIRLRQLVSTKDAVIKDLRASKKSVAQELETARLAVKAAEETSATLRAQRDKAMDKAIRAGRILMRRPGVVVPDDIRADVNAAPDSSSRPSSSVAPK
Ga0214277_11273602Ga0214277_112736021F052316MARVGPRGLDGQEIPVRLVYDQVKTFAKFSQQDCKLDNLLDGLEEEEVFESK
Ga0214277_11276995Ga0214277_112769951F093003LRADQDLLADRWTEVLAADEYKLERPSKSYPKRRLLPQLEEEATKPTSPAYDAADRPPRGRDREAFRPSTQAAPRRRSKNTRARGNAPDLRDILEDKARQTRSIYGSRGRRTSRDDNRHAGYDKYGHAEHNRQSSSELRRDIAQYRGTAHPLCFTDEVMDRQIPEGFKPVNIESYDGTTDPAVWIEDHLLHIHMAHGD
Ga0214277_11281567Ga0214277_112815672F050219MSEDKKAVGDSKLSLSEEMHLSFLQSMLKTNTEKITKEILEGLSEDTGDSDSYD
Ga0214277_11284987Ga0214277_112849871F027342LTRVRNSPGAFSYLPRSVSDAAKFYQAEEGRSTEKLFWSQYIGTEHPMPLSDQLKQLVELHKVAEQAMKGFIVRMWPGDSLPNNYFGLVRRLVDACPRLEVIKRSVCIEGARRAFARAKVHWAKMDAVKLVKEGPPQGKEHRHPEMYYEGVLKGARLVADECAKDVIFE
Ga0214277_11298366Ga0214277_112983661F038084VVIHTVKGFGIVNKAEVDAFLELFCYFDDPVDVGNLHSGSSAFSKTSLNIWKFVVHVLLKPTLENVKLY
Ga0214277_11304041Ga0214277_113040411F038012MITEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWG
Ga0214277_11304167Ga0214277_113041672F083289MPGHNGTITVHGSRKVALECEEGDAAYAESVCATEELKFYKDNVDPTDMTSLKKPTTEHEPAMKFKSADETKLVDFIPGDSSQQFSISANLDPK
Ga0214277_11304299Ga0214277_113042991F057793TPSIRMSEEEYFKLKALKEKYDISWTEFIKYVNKLVEKDMRKNGY
Ga0214277_11306087Ga0214277_113060872F059631ARRRMGRTPDFRSGPPTRLTSWKETGLSWGKKGELTGLQTCIQTLVDKKLKLVNVVQVMLIRRILPCQQRAFNLWEFDPARHRTRSRLFDMTYEDAWKVLFKGAEAPTSATEDRGFSAQHHALAVSCFFLLQGISLS
Ga0214277_11306809Ga0214277_113068091F052316MVKTHYTTADPNHMAEVGPVGSDGKEIPVILVYDQVKLAAKYSQQDCRLDSMLDGIEDEFSQSK
Ga0214277_11309474Ga0214277_113094741F027342VKKHETLELDSKTRESELAAALESTKHAKAEAQKALQGIEAMRKIAAGKAFNMQSKRVKLNYLLLTRVRSSPGAFADLPRSVSDAAKYYQAEEGSSTEKLFWSQYTGTEHPMPLSDQLKQLVELHKVAEQAMKGFIVWLWPGDALPNSFFGLVRWLVDACPRLEVVKRSVCIEGACRAFAHVKLQWVKLDVVKKAIATYKTIKC
Ga0214277_11309500Ga0214277_113095001F071823SLVAQMVKNPPAMWENWVRSLGWKDPIEKEMATHSSVLA
Ga0214277_11317516Ga0214277_113175161F035108MSVGVLTGRPVEEMPGFTGDLLPELSQLHERVRQVMQGAAQALWPSISMPEGLGELIERLKGARRRFRLWKILACHQGAREAWAMVKTRYTKDDPNHMAEVGPVGPDGKEIPVSLVYGQVELTAKYSQ
Ga0214277_11321219Ga0214277_113212192F083289ECEEGDATYAESVCATEELKFYKDNVDPADMTPLKKPTTEHDSDLKFKSAAETKLVDFVPGDSSKQFTVSANLDPK
Ga0214277_11322473Ga0214277_113224731F032472PSAIHAQFGTPYPRSAGFDTDIAAFIESSSVSSPIGSMATSTIINDAVQGETFLPGQIFVFGGFALWANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDRFEPRPGAPHCHNGHDLALPSDNTQSVAQVSALTISSEPTTPVGDGRLDATPDSDRPAPLPIESDSAPIMEFTAADIFQHSPFGDI
Ga0214277_11335349Ga0214277_113353491F001813TEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214277_11335902Ga0214277_113359021F001813TEPGGVQREFGCCVEGYGLARTIGDGQMVGLDDPVGLFQP
Ga0214277_11341214Ga0214277_113412141F038489MTWVEKDRNDHPVSTPCYVQGHQPADQAAQSHIEPGLECLQGR
Ga0214277_11343016Ga0214277_113430161F020492MGLQAVLLTSATLTAEVGTLKQDLERSERELGHAKRQLKDKEGE
Ga0214277_11343639Ga0214277_113436391F052316MVKTWYTKLDPNHMARVGPLGLDGKEVPVNLVYDQVEVAAKYSQQDRKLDRLLDDIEEEIFESK
Ga0214277_11351385Ga0214277_113513851F086390RKSKFRNFLASITVGESRDITQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLSVLRSAVLGDKHYNLGAIVARRLHNNRFNGDFFGGIYATRLANFLDIPIRGYDIELPPVYLDYEAMVRHQFVERNDQFLQYRLIFDRRRTYHVALPASTFFDFQAKVRYFITREEAEEYKRRAEIARLQAAAHDAISTASQYNPSYNFGCPPGQPWQ
Ga0214277_11354496Ga0214277_113544962F065281MAKKSIVTSIRLNEDDYLKLKQLKEQYGISWTKFESYVNELVENEMKKDRRDDHDKK
Ga0214277_11361257Ga0214277_113612572F093003MAATEAFRPSTQAAPRRRSKSTKARENAPDLRDILEDKARQTRSIYGSRGRPTARDGTRHAGYSKSGRAEHSRQSSFELRRDIAQYRGAAHPLCFTDEVMDHQIPEGFKPMNIESYDGTTDPAVWIEDYLLHIHMARGDDLHAIKYLPLKLKGPAGHWLISLPVELIGSWEDLEA
Ga0214277_11366954Ga0214277_113669541F105149MFRKMYQGGSSRKQGLRPAIRDADEEPPRDAQVRPCEWPSEDFMIQAGIKEEFDAYVCNADLESFEADKCRQYLYLTDSFVRRFKFSSSRNSQTVLFDLYDKSYTMDLEDFTTACKLPQWGSASEPRKSEFKDFLASITVGESREI
Ga0214277_11371975Ga0214277_113719751F092835VCLCVGRQDTQFGPIPARFVDYYSLFWGLEVISTIDEPQGASWCRSSTLAGFADSDPFRRLLLTVLGSQRDFHF
Ga0214277_11375799Ga0214277_113757992F053764MVNTEIRLIIFFAAKNGETIQPAEQDRELPVAQIVNSLLPNSDLN
Ga0214277_11390081Ga0214277_113900812F020492MHMQASLLASAALTSEVDTLKQNLERSEQELGRAKKQLEDNEGKKYLV
Ga0214277_11392084Ga0214277_113920841F020828MKGLIGRLWPGEVLPESYFGLVRWLVDACPWLEVIKRSVCIEGARRALARAKVHWGKLDAEKLVKDGPPEGKEHRWPEMYYEGVLKGARLVADECTRDVIFEKTRSVLSCALKTCSYALSNAF
Ga0214277_11392949Ga0214277_113929491F093003VSLGDEEFIVPEDPVEQERFKRRLIAIANSLKKRQQQLRADQALLADRWTEVLAAEEYELERPTKSYPKRRLLPQLEEEALKPTLPAYDAADRPPPGRDRVTYQPEVQLALRHKSNKNAKARGHTQDLRDVLENKAGHTRSIYGSRGRAPTRDDDRHAGYTKSKSGRAEYSREESYELRRDIARHRGAAHPLCFTDEVMDQEFPEGFKPVNIE
Ga0214277_11396481Ga0214277_113964811F011632VQQGKGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLVGTIGEERTVGLDDPLGLFQP
Ga0214277_11398039Ga0214277_113980391F093003LIATAKSLKKKQQQLQADQEMLADRWTEVLVAEEHELERPSKRYPKRRLLPQLEEEALKPALPAYDVADRPARGRDRGAYQPEVQPAPRRQTNKNTKARGNMRDLQDVLENKAGHTRLIYGSRGRATTRDDDFHAGYTKSKSGRAEHSTQDSYDLRRDIAQHRGAAHPLCFTDEVMEHQFPERFKPMNIKSYDGT
Ga0214277_11400176Ga0214277_114001761F052316RYTKADPNHMVEVGPVGSDGKEIPVSLVYDQVALAAKYFQQDCMLDRMLDGIVEEFSQSA
Ga0214277_11401050Ga0214277_114010501F034384MFGKYFQLWLFPFDYPLDLVIILAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMDVFRLESRVAAVVDYLARLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0214277_11407391Ga0214277_114073911F004001YWNTLPREMVESSSLEVFRNCVDVALRDVVSGHGGDGLVVRLDELSGLFQL
Ga0214277_11417216Ga0214277_114172162F001813QRGGGVTEPGGVQGAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214277_11417929Ga0214277_114179291F020828MPLSDQLKQLVELHNAAEQAMKGFIVRLWPREALPGSYFGVVRRLVEACPRLEVIKRSVCIEGARRALARAKVHWGKLDAEELVKDGPPPGKEHRKPEMYYKDVLKGAYLVADECARDVIFE
Ga0214277_11418807Ga0214277_114188072F020492MRVQASLLASAVLTAEVDTLKQSLEKSEQELGRAKKQLEEKEGKKYPV
Ga0214277_11421594Ga0214277_114215941F035108AEEMSGSTGDLLPELLQLHERVQQVMTGVVQALWPSVSLPEGLGGLAEKLQGARQSFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGFDGKEIPVSLVYDQVKLSAKYSQQDCRLDSLLDGIEEEFRQCK
Ga0214277_11422839Ga0214277_114228391F006329MKLELHVADVVDDHKIQMDEMRLKIRKIRKYAIDNDAWYHYVVGSIVTLVAILIAFVVAFNSLARDLFVCCI
Ga0214277_11430752Ga0214277_114307521F004815QAFKARLDVALGSLGCWLATLHIAGGRNQMDIEVLFNLGHSMML
Ga0214277_11433921Ga0214277_114339211F096317VSYVNKQASLLAAAARTTVVSGLKRDLERFEEELGLTKRQLEENKGK
Ga0214277_11434111Ga0214277_114341111F004815RLDVALGSLVCWLATLHIAGGWNEMSVMVLCNPGHSMIFS
Ga0214277_11441054Ga0214277_114410541F033854MAAEGQCDKIMSDMEVCMKQRCVSPFLHMEKMAPTDIHRCFLNISGGQRVDVST
Ga0214277_11446826Ga0214277_114468261F001813VQRVFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214277_11449127Ga0214277_114491272F020828MPLSDQLKQLVELHKAAELAMKDLIVRLWPGEPLPDSYFGLVKRMVNAYSRLEVIKRSMCIEGARRALARVKVHWAKMDAGKLVKEGPPKDKEHRYPEK
Ga0214277_11451376Ga0214277_114513762F028669MYARREIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0214277_11468392Ga0214277_114683922F038084SGIPISFRNFPQFIVIHTVKGFDIVNKAEIDAFLELSCFLHDPADVGNLISGSSAFSKTSLNIRKFTVRVLLKPGLENFEHYFTSV
Ga0214277_11469373Ga0214277_114693731F015450NSKLLRQSEQFEREKQDLNEKLEAGAQQNSDLRKLLTNLQEKCLEFSNKCIQRLRKIFYSVGASSEKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFLKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLEPVRNHTLCLPFLASSILTYNDLIHVG
Ga0214277_11482778Ga0214277_114827781F034384GRLEVNLDPINSPVKDEVAMNVLRLESRVAAVIDYLARLKVATSRIDTTLWPRETLQNNLESLMTRLNEVPSRVQEWKKSSARCGADVALSLVRVHCKDAREDKLVALRVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEG
Ga0214277_11485456Ga0214277_114854561F020828MKGLIVRLWPGGALPGSYFGLVRQLVEACPRLKVIKRSVCIEGARRALARAKVHWAKLDVEKLVKDGPPPGKEHRKPENYYKDVLKGACLVADECSRDVIFE
Ga0214277_11485993Ga0214277_114859931F032472NSLGHLEQIESYVPGHQVRFGSLNYTDAIRRDLIFDGFEPQPSVPRCHDGHDLALSPDSALEATHESALTHSSEQTAQIEDKWLDTASGAATSTAIEPNTDLVPYKARDSEAPDSLLDSEPPAPLPIKFDWAPIMEFTTADIFQHSPFGDILNSLKSLSLYQESPGRTMVSIVGIRTTKK
Ga0214277_11490736Ga0214277_114907361F076748IRKWDNFFIPTPMRFIQLPGGYPTLYVSKSSFLQSDSSWFDWNDEEAVL
Ga0214277_11492888Ga0214277_114928882F096317LNVNKQAVLLAAAARTVEITDLTQDLERAQGELGLTRRQLEESKGE
Ga0214277_11493046Ga0214277_114930461F059631AMVGKMPNVTWLEGAFVESVKGWQLGWFYITELRDPKWAAAPEFRSGTPMQLTSWKEKGLLWGSSEELTGLQSCLQTLVNKKLRLVNVIQVMLVRRILPCQQRAFNLWEFDPAQHRTLSGLFDTTYEAAWRVLFKGGEAPASATEDCGFSTKRPAGEVSFVILYGTFIFFHSLTLCGI
Ga0214277_11493738Ga0214277_114937381F027342GAFTDLPRSVLDAAEFYRAQEGSSTEKMFWSKYAGAEHPTPLSDQLKQLVELHRAAEVAMKDFIVRMWPGEPLPTSYFGLIKRMVNACPRLEVIKRSVCIEGARRALARAKVHWGKLDAEKLVKDGPPEGKAHRYPEKYYDGVMKGAHLVADESTKDTILE
Ga0214277_11495401Ga0214277_114954011F079404VPCSKKGSIYQVGGAEVWHIAGTGYLSGTPKKTSEDWPSEWFYIEDVPLPDPIRIGLPEFDNAPSKKRQSWRPRSPLEEDDRDILYLMSRISSLAQSGLTMIEVMAICIMRGVQLLQYRGHPMRDFNGEDDATRHGRIGPGSAADLIKILSTLYKGEEEEFLRVNPQGGFSMYNPPSWVSGDFFSPIRLVFP
Ga0214277_11496988Ga0214277_114969882F096317VNKQAVLLAAPVRTTEVAGLKRDLELVQGALDLTKRKLEENKGL
Ga0214277_11498475Ga0214277_114984752F067310LLWLEETLQNDLESLMTRLNEIPSRVQEWKKSSARCGADVALSLVRVHCKEAREDKLVSLKVANTRKHDLRSFMETYTAAATRIADGIDLDEFVAPSSPPQEG
Ga0214277_11510028Ga0214277_115100281F081962NQSVLTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLVVLPQRFQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDTDLTKYQPGHDAENQRIPTPRYEAVSLIPPTRKHTFAPEVDPAGLIDDEPQFEALSGIDWKSSNFQDMETAEGAERDEPEA
Ga0214277_11510617Ga0214277_115106171F027342LLLTRIRSSPGAFADLPRSVSDAAAFYWAKEGISTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARAKVHWGKMDAQKLVMDPPPEGKEYRTPEMYYKSVLKGARTIAGECSKDVIFE
Ga0214277_11510919Ga0214277_115109192F020828MKVLIVRLWPREAMPGSYFGLVRRLVDACPWIEVIKRSVCIEGARRALARAKVHWGKLDAEKLLTDTPALGKEYRTPEMYYKGVLKGARLIAGECSKDVIFE
Ga0214277_11519220Ga0214277_115192201F086390YDTSYTMDLEDFTTACKLPQCGNINDPQKSEFRDFLDSITVGESRDIAQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLCVLKSAVLGYKGYNLGAIVARRLQNNSRKGNLFGGIYATRVANYLGIAPREGDMVLPPAYLDYDAMVKHHFLLKTEQFLQYRLIFDRRRAVHVTLPTPILFDYQAKGRYFITREEETKYERRTEAARRHVAAQ
Ga0214277_11521544Ga0214277_115215441F012765MEELDNQRRQLQESSDEVTRLTQLLSAKDATIKGLRASKKSIAQELEAAQLATRVAEETAVTFKAQRDKALDKAIRAGRILMRRPGVVVPKDIRADVNAAPDSSNRPSSSVVPEKDIGK
Ga0214277_11523343Ga0214277_115233431F059631EAFLCIQPHFGLWIKTFNIKPKVVKGSQAECGGAMVGRMSNVTWLEGTFVETIKGWQSGWFYITEPRDPEWAAAPEFRSGIPTRLTSWKESGRIWGDSEELTGLQACVQKLVDKKLKLVNIVQVMLIRQILPCQRRGFNMWEFDLAQHQTLNGLFDTTYEEVWKVRFKGAEALASAAEDRRF
Ga0214277_11524656Ga0214277_115246561F004001VTQLPREVVGSPSLEVFQNHGDVAQRDVGSGYGGCVGVGIDLGGLFQP
Ga0214277_11535596Ga0214277_115355961F034384MNVLRLESRVAGVVDYLARLKVAMSRIDTALWLGATLQNDLESLMTRLNEIPGRVQELKKSSARCGADVALSLVRVHCKEAREEKLAAIKVAHTKKHDFQSFMETFIAAATRIADGMTWTNSSSLPV
Ga0214277_11547211Ga0214277_115472111F035108MSVGMLTGRPAKEMPGSAGDLLPELSQLHEQVRQVMQGIAQALWPSVSLPEAIGDLAEKLKGAQRRFRLWKISACQQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYGQVELATKYSQQDCKLDRLLDGIEEEFSQPA
Ga0214277_11550236Ga0214277_115502361F086390PPWGNVSEPRKSEYKHFLAIITMGESREITQATIGSIHFPSIHYVALFIGRCIKGKDEACHMCVPDLSVLKSAVLGDKQYNLGAIVARRLHLNGTSGDLFGGIYATRVANYLDVPIHENDMELPPAYLDYSAMVRHQFLERNEQFLLYRLIFDRQRTVHVALPAPTFFNFQAKRRYVITREEANEYKERAEAARLQDATHQAIVTASQY
Ga0214277_11556581Ga0214277_115565811F020828LFWSQYTRTKHPMPLSDQLKQLVELHKAAELAMKDLIVRMWPGEPLPSSYFGLVKRLVNACPRFEVIKWSVCIEGARRAFARAKVHWAKMDAEKLVKEGPPKGKEHCHPEKYYDSVLKGARLVAEECAKDVIFE
Ga0214277_11557108Ga0214277_115571081F011632AAQRGGGVTEPGGVQRAFVCCVEGRGLERTIGEGRMVRLDDPVGLFQP
Ga0214277_11558470Ga0214277_115584701F076748MGFIQLTGDSTPLYVSNTSFLQSDSSWFDWNNKEVALFPNWETGIN
Ga0214277_11558546Ga0214277_115585461F038489MAWVEKDHNAHLVSTPRYVQGRQPPDQAAQSHIQPSLE
Ga0214277_11564978Ga0214277_115649781F076912LENSTPLCNGEGSNADKVQDSETSLLVSKKADKNYLDDSERTQKSCLDVVFELLATTAGTSSSNSLPELVHLLESQLQVERHQSDVLRQEAEGPRKSLQNSDAYFLAQQQALEDLSAKQEKVNKIAKHLMGT
Ga0214277_11565084Ga0214277_115650841F002994ENKKHVKVKNAYAQEIEKCEKLTSELSICHDTISNLRIENDKLIAKVEKLNVCDDSLVNLKNDNASLIAKIDRLNESVSSLKIENDKLMSKTKDLNVCIVSISNHRNENAMLHAKIDELNVCKPSTSTVDHVSICMRCRDINVDAIHDHLTLIKEQNDHIAQLSAKINEHE
Ga0214277_11565684Ga0214277_115656841F081962MLNNAGPRSTNLKQNMVIKLKAVYTLVEQLYTGSQRALAVVALSNDVPYLLQDVLKRLAVLPQRIQELRRASARAGAIAALSRAKAWLPELDPADIALGYPSLKEDDTVFNDKNFTACVKDIRPVATLIGNDTDLTKCQPGYDKENRRIPMPHYNDVSLIPPTRKHTFAPEVDPAGLIDDEAEFEA
Ga0214277_11568774Ga0214277_115687741F086390SILRSDVLGDKSYNLGAIVARRLNLTRFNGDFFGGIHATRLADFLGVTIRNDDIELPPAYLDFNAMVHHQFVERNESPLQYRLIFDRRRAVRITLPTPAFFDYQAKGRHFITREEADEYERWAEAARRHAAAQEAITAASQYDPGYNYGYPPGHPWQ
Ga0214277_11578426Ga0214277_115784261F105149MYQGGSSTKRGPRRAMREKDDEPPRDAEVRACEWPSEKFMVNAGIKDDFDAYVHNADLEDFIQDKCPQYYQLTDSFVRRFKYTSSCNSKNVLFDIYDLSYTMDLEDFTTACKLPQWGNVHEPHKSEYKDFLASITVGECRDIAQATI
Ga0214277_11579368Ga0214277_115793681F105149MYQGGSSRKQGPRPAIREPDHELPREAQVRPCEWPSEDFMVRAGIKEEFDAYVRNAELEGFMLDKCPQYYHLTDSFVRRFKFSSSRNSHTVLFGIYGKSYTMDLEDFNTACKLPQWGSVMSTTQPSSCRR
Ga0214277_11579796Ga0214277_115797961F035108MSVGMLMGRPTEEMRGSAGDLLSELSHLHEQVRQVMQGVAQALWPSVSLPEGVAELAEKLKGARRRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPMGPDGKEIPVSLVYGQVELATKYSQQDCKLDRLLDGIEEEFSQSA
Ga0214277_11580888Ga0214277_115808881F006329MILELHVANVVHNHKIKMDAMRLKISKIRKYAIHTEAWYHYAVGSIVTLVAITIAFVFALKCFT
Ga0214277_11591952Ga0214277_115919522F035108MSVGAFTGRPAEEMPGSTGDQLPELVQLLERVRQAMSGVVRALWPSVSLPEGLGELAEKLQGARQRFRLWKISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPVSLMYGQVELAAKYSQQDYKLDRLLDGFEAEYNLSV
Ga0214277_11593316Ga0214277_115933161F052316MVKTRYTKSDPNHMAEVRPVGPDGKEIPVSLVYGQVELAAKYSQQDCKLDGLLDGIEEEYNQSE
Ga0214277_11602348Ga0214277_116023481F001813TDPGGVQRVFGCCVEGHGLVRTIGEGRMVGLDDPVGLFQP
Ga0214277_11605788Ga0214277_116057881F053764MVDTEIRLIIFFAAKDGEALYSQQKQDLEVTVEVTVAQIMNSLLPN
Ga0214277_11610681Ga0214277_116106812F067310VQEWKKSSARCGADVALSLVRVHCKDAREDKLASFRVANTKKHDFQSFMETFIAAATQIADGINLDQFVAPSSPPPEE
Ga0214277_11612152Ga0214277_116121521F076912LEKSTLLCNVKESNADQVQDSETSLLFSNKADKNYIEDTETTPKFCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVQRHRSYVMRQEAEGLRKSLQNSDAYFLVQQQVLEDLSAKQEKVK
Ga0214277_11612973Ga0214277_116129731F086390TAACKLLQWGSATEPRKSEFRNFLASITVGESRDIAQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLSILRSAVLGDKTYNLGAIVSRRLHHNRFNGDFFGGIYATRLADFLGVDVREDDIELPPTYLDYNAMVHHQFVERNESPLRYRLIFDKHRAVRITLPAPAFFDYHTKGRYVITREEADEYDRRAEAARRHAAAQEVIATASQYDPN
Ga0214277_11617084Ga0214277_116170841F032472PRSASFDTDIGDFIESSSVSSPIGLMAPSINNNAVQGETFLPRQIFVFGGFTLRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFNGFEPQPSVPHCHDGHDLALPSDSDQSATQVFTPTISSEPTALARDGRLDAAPGSAISTAIEPNTSIVLCKARDSKVPDSFSNSEPSAPLPIESD
Ga0214277_11617236Ga0214277_116172361F035626MAPSIINNDAVQGETFLPRQIFVFDGFALWANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPLPSVPHCHDGHDLAMLPDSALEAAQVSAPTLSSEPTAPIEDGW
Ga0214277_11626528Ga0214277_116265281F035626MAPPIINNDAVQGETFLPGQIFIFGGFALWANSLGHLEQIESYAPGHQVRFGSLKYMADVRGDLIFDGFEPQPSASHCHDWHDLALPPDSAL
Ga0214277_11626710Ga0214277_116267102F020492MGMQAVLLTSAALTAEVTALKQSLERSESELGRAKKQLEDKESK
Ga0214277_11628830Ga0214277_116288302F020492MGLQAALLTSAALTAEVNAVKQSLERSENELGRAKKQLEDKEGE
Ga0214277_11635170Ga0214277_116351702F104139VDPSSTFSGQSGTLLAPELPWVGPAFLPGAQSLLQAVTRHFHYS
Ga0214277_11642480Ga0214277_116424802F083289TPGHKGTITIRGSRKIALECEEGDAAYAESVCAAEELKFYKDKVDLADMTSLKKPTTEHDPALKFKSADETKMVDFVPDDSSKQFIISANLDPK
Ga0214277_11642748Ga0214277_116427481F006329LKEKIKRIEEEKMTLELYVADVVDDHKMKMNAMRLKMDAMRLKLKKIRKYAIDTEAWDHCAVGSIVILVAIFIIFVVMRVSFLY
Ga0214277_11643456Ga0214277_116434562F035108MPGSMGDLLPELLQLHERIRQAMSGIVQALWPSVSLPEGLGGLADKLQGVRQRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLMYGQVELAAKYSQRDCKLDSLLDGVEEEFNQSI
Ga0214277_11647700Ga0214277_116477001F067310VGLHYCKDAREEKLAAIQVANTRKHSFQDFMETFIAAATRIADGIDLDEFVAPSSPPPEE
Ga0214277_11653998Ga0214277_116539982F001813VQRAFGCCVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0214277_11665550Ga0214277_116655502F004001SLGVLKNSGDVAMGEMDSGYGGDGLTVGLDDLSGLFQP
Ga0214277_11665854Ga0214277_116658541F020492LGVQASLLASAVLTAEVDMLKQILEKSEQELGHAKKQLEEKESKKYLG
Ga0214277_11668400Ga0214277_116684001F096317VNKQAVLLAAAVRTTEIARLKQDLEQARGELDLTRRQLEKNKGE
Ga0214277_11674149Ga0214277_116741491F105149MFRKMYQGGPSRKQGPRLAIRDVDDEPPREAQVRACEWPSEDFMDRAEIKDEFYAYVHNADLESFEADKCRQYHYLTDSFVRRFEFSSSRNSQTVLFDLYENSYTMDLEDFNTACKLPQWGSPNEPRKSEFRDFLASITVGESRDITQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLSILRSAVLGYK
Ga0214277_11676965Ga0214277_116769651F006329MKRIEEEKMKLELYVADVVDDHKMNMNAMHLKMDAMRLKIKKIRKYAIDNEAWYRYAVGSIVTLVAIIPMYVLIRCSS
Ga0214277_11684598Ga0214277_116845981F094706VIISQQVVPTVGLSHDGFEFLKGNFEGLKGYAVGRMTKSRRGRIYIDDAGWAPEADSIEYGYRVPFGGIHIFIRKIGEPGPEPDISTDLIETAQCASPAWVQPSIKRAFVGFIHGAGSEPVSDGETAIYLDVESSTGETESLYQL
Ga0214277_11686536Ga0214277_116865361F001445TTTFQKEMATHFIVLAWRIPRTGEPHGLPSMGSHRVRHD
Ga0214277_11686755Ga0214277_116867551F027342QKALQELDAVKKKVAGKAFFMKSRHIKVSYLLLTRIRSSPGAFTDLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLFELHKAAEQDLKGFLVRLWPGEALPGSYFGLVRRLVEACPRLEVIKRSVCIEGARRALARAKVHWG
Ga0214277_11687561Ga0214277_116875611F034384LLAAELCQDFDKETGRVETGLDPIASPVYDETAMNVLRLESCIASATSYLARLKEVVSRIDSSLWPGATLQNDLESLMTRLNEIPDRVQEWKKSSARCGADVALSLVRVHCKEVREDKLAAIKVANTKKHDFQSFMETFIAAATRIADGIDLDSFVEPASPPPAE
Ga0214277_11690087Ga0214277_116900871F020828MPGSYFGLVRRMVDACPWMEVIKHSVCIEGARRALARAKVHWGKMDAEKLVTDAPPPGKEYRKPEMYYEGILKGARLIADECSKDVIFE
Ga0214277_11695498Ga0214277_116954981F081962TKLKAVYTLVEQLYTRSQRALAIVALSNEVPTHLADVLKRLAVLTQCFQELRQAFARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAVSLIPPTRKHTFAPEVDPAGLIDDEAQFEALSGIDWKSSTFQVMETAGGAERDEPEASTRQAS
Ga0214277_11698736Ga0214277_116987362F057793MAKKSVTPSIRMNEEEYLKIKALKEKYNISWNELIKCANRVLSEDMKTKEKK
Ga0214277_11703035Ga0214277_117030351F005658MAWVAKDHDAHLVPTPCYVQGCQPADQAAQSHIPPGLGCLWGW
Ga0214277_11710802Ga0214277_117108021F010678EASSKVLDYIIRHASGKKLSEEEIFEANHYARELKYPKGALVFYGTDEDDFLYCLPDNKELSVCREMARSIGFPKLEAGLCAMTKDDLADSLAYNSLKV
Ga0214277_11712911Ga0214277_117129111F052316MIKTRYTKPDPNHMAEVGPMGPDGKEIPVSLVSGQVELAAKYSQQDCKLDRLLDGIEEEYTESD
Ga0214277_11715013Ga0214277_117150132F067310VALSLVRVHCKEAREEKLAAIKVANTKRHDLQSFMETFIAAVARIADGIDLDEFFEPASPPPAE
Ga0214277_11715844Ga0214277_117158441F052316TKMDPNNMAEVGPAGPDGQEIPVSLVYDQVALAAKYSQQDCRLDNLLDGIEEEYSHS
Ga0214277_11716675Ga0214277_117166751F103019VRARMLFFHHAGKMSSIPPPAGGLSAAIVVVARRWKEYHVVAAVEGHELKTPETEHRPGSERLLETAHLELDGKLFVNTQQTPTWRANYRRFETGGSQSR
Ga0214277_11724618Ga0214277_117246181F020492MGLQAALLTSAALTAEVNNLKESLAQSENELGRAKKQLEDKEGM
Ga0214277_11724649Ga0214277_117246491F086390GSVRDPPKSEYRDFLAKITVGESRDITQATLGSIHFPAIHYFSLFIGRSVNAKDEACHMCAPDLSILSSAVLGDQSYHMGAIVARRLHHNRHNGDFFGGIYATRLANFLEIDIRESDMELPSTYLDFDSMVSHQFVERTEPPLQYRLIFNRRRVVHIALLAPAFFDSQGKRRYIITREEADEYERRVEAARLHATAQATIAAASQYDPTITLDIRQASRGNR
Ga0214277_11724867Ga0214277_117248671F027342ALRELEDVKKIAASKAIFMQRRNIKVNYLLLTQIRSSPGEFADLPRSVSYAAAFYRAEEGSSTEKVFWSQYAEAGHPGPLSDQLKQLVELHKAAEQAMKGFIVRLWPGEALPGSYFGLVRRLVEACPRLEVIKRSVCIEGACRALARAKVHWGKLDAEKLVKDGPPSGKEHHKPENYYKDVLKGACLVADECSRDAIFE
Ga0214277_11730589Ga0214277_117305891F059631VVCEAFLCIQPHFGLWLKTFNVKPKVVKSTQAECGGAMLGKMPNVLWFEGAFVESVKGWQSGWFYITEPRDPTWAAAPEFRSGIPMQLTSWKEKGLLWGSSEELTGLQACIQKLVKKLRLVNVVQVMLVRRILPCQERAFNLWEFDPEQHQALRGLFDTTYEGAWRVLFKGAEAPASATEDRGFRSQRQAD
Ga0214277_11733684Ga0214277_117336841F062313MTEDEMVGWHLRLNGHAFGWTPGVGDGQRALVCCSSSGRKESDMTE
Ga0214277_11739106Ga0214277_117391062F020492MGMQVALLTSAALTAEVDALKQSLERSENELGLAKKQHEDKEGR
Ga0214277_11742340Ga0214277_117423402F083289KMPGHKGTITVHGSRKIALECEEGDAAYAESVCATKELKFYKDQVDPADMTSLKKPTTEHDPALKFKSATHTKMVDFVPGDSSKQFSISANLDPK
Ga0214277_11746933Ga0214277_117469331F086390QATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLSILRSVVLGDKSYNLGAIVARRLHLNRFNGDFFGGIYATRIANFLGIAIREDDIELPPAYLDFNAMVHHQFVERNESPLQYRLIFDRRRAVHITLPAPAFFDYQARGRYTITREEADEYERRAEAAHRHTAAQQAIAAASHYDPNFYYGYPPGQPLP
Ga0214277_11749028Ga0214277_117490281F094706VTNPRQLAPTVGLSHDGLTILAGKLNGLEGYAMGRMTKSRRGKIYIDDAGWGPEADSIEYGYRVPFGGIHVFIGKIGEPGPEPDICTDLVEMAQRARSTQAKPAMKSTFVGVIHRGEREDESEQGSETVVYSGDESSTRETESLYQLQDDQVRGCSDGDS
Ga0214277_11760516Ga0214277_117605161F002994LDSQEDFLIKENKKHVKVKNAYAPEVEKCEKLSRELSTCHETIDNLRNENANLLAKVDSNVCNDSILNLSDDNANLLAKIEKLNDSLASLRIENEKLIAKAKDFDVCNITISNLRSENDILHAKVVELKSCKPSTSTVEHTSICTRCRDVDINAIHDHMALIKQQNDH
Ga0214277_11762095Ga0214277_117620951F105149MYQGGSSVKKGPRIAIREQDVELPRDADVRACEWPSDDFMVEAGFKEEFDVYVRNADLEDFLQDKCPRYYQLTDSFVRRFKYNCTRNSPSVLFDIYDTSYTMDLEDFTTACKLLQWGNVHEPHRSEYKDFLASITVGESRD
Ga0214277_11764184Ga0214277_117641841F035108MLTGRPEEEMPAFTGDLLQDLSQLHERARQVMQCVAQALWPSSFLPNGMGELVDLLQGDRRRFLLWKISAYRQGAREACAMVKTRYTKLDPNHMAEVGPAGPDGQEIPVSLVYDQVALAAKYSQQDCKLDSMLDGIAEEYSQSK
Ga0214277_11765883Ga0214277_117658832F014346VVFAKTLESPLDCKEINPVHPKGDQSWVFIGRTDVEAETPILW
Ga0214277_11767012Ga0214277_117670121F027342DLPRNVSDAATFYRAEESSSTEKVFWSQYAKAGPPVPLSDQLKQLVELHKAAEQAMKGFIDRLWPGKALPGSYFGMVRRLVEACPRLEVIKRSVCIEGARTALARVKVHWGKLDGEKLVKDGPPPGKEHRKPENYYKDVLAGACLVADECTKDL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.