| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300020684 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063444 | Gp0053528 | Ga0214214 |
| Sample Name | Freshwater microbial communities from Trout Bog Lake, WI - 07JUN2007 hypolimnion |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 49921885 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → hypolimnion → lake water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Trout Bog, Vilas County, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.041 | Long. (o) | -89.686 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004124 | Metagenome / Metatranscriptome | 452 | Y |
| F028086 | Metagenome | 192 | Y |
| F098526 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0214214_105335 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| Ga0214214_107372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
| Ga0214214_114045 | Not Available | 721 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0214214_105335 | Ga0214214_1053351 | F004124 | RVWQDGRVKRKSSPSRPPRRHLTAKEKAEVLREHRRSGLSLLAFVRKHGLCYSTLLRWRSRPGQGALVVAPPDLEADPRFVPVKVEGEVLSGDYVLSWAGGRSLKIPPQFETDSLRRLLGVLEALR |
| Ga0214214_107372 | Ga0214214_1073722 | F028086 | MTDEKIPFGGSMKVPSDDCEEAFFALYPDFFYEGSTALNLWIQSWQSALDWIEDNKKVIQLL |
| Ga0214214_114045 | Ga0214214_1140451 | F098526 | MAYSIFTAAETEAFFNSIPDVGVINRQTNPTGHKVVINNITYSILFDHNGAFWTIFEHPNGSLDRQSKILQRIHQSYTTYCCGVWQLGSFYCPFDVPHEIEDLMIKMIASCARYKFAKGVMQAYFYRSRSKSSSYQHDRILKAFIRNGFVDNSPETFNPNSGNMIKGLVRPCQPPKEKRATRAMLQQRLDNILGVIHGNT |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |