Sample 3300020071

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300020071

3300020071: Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2)

Overview

Basic Information
IMG/M Taxon OID	3300020071 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0090294 \| Gp0175827 \| Ga0206348
Sample Name	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	7213148
Sequencing Scaffolds	1
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → rhizosphere → soil
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere

Location Information
Location	USA: Michigan
Coordinates	Lat. (^o)	42.3948	Long. (^o)	-85.3738	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002974	Metagenome / Metatranscriptome	516	Y
F078550	Metagenome / Metatranscriptome	116	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0206348_108127	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0206348_108127	Ga0206348_1081271	F078550	VTAKDREGVNPRLQGGVWETPLAEEIRVSPECSAYMGAWKDQDWM
Ga0206348_116366	Ga0206348_1163661	F002974	GIIRRPENVKRGRGRPTLTWTEAVKRDLKEWNIDKELAVDRKGWKCAIHVPEP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.