| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300019928 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129143 | Gp0217705 | Ga0193763 |
| Sample Name | Arctic soil viral communities from Stordalen Mire, Sweden - P+N3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Restricted |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Dataset Contents | |
|---|---|
| Total Genome Size | 510049 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Arctic Soil Viral Communities From Stordalen Mire, Sweden |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Arctic Soil → Arctic Soil Viral Communities From Stordalen Mire, Sweden |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → palsa → permafrost |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sweden: Norrbotten County, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3526 | Long. (o) | 19.0147 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009559 | Metagenome | 316 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0193763_10095 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 679 | Open in IMG/M |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0193763_10095 | Ga0193763_100951 | F009559 | MNQVLLYASVLLAVVSFFLCLYACARVGKLLNSVKGLDWDTIACRTGDIGTIKKSIQTL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |