NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300019763

3300019763: Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_5_MG



Overview

Basic Information
IMG/M Taxon OID3300019763 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129088 | Gp0217628 | Ga0193962
Sample NameMicrobial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_5_MG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size316234649
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Sediments And Microbial Mats In Various Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomerivermicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1644Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036294Metagenome / Metatranscriptome170Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0193962_1049912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina1106Open in IMG/M
Ga0193962_1172039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0193962_1049912Ga0193962_10499121F036294MDRWFSDEAIVGVKLAADEDAVTYQRVKLLESDKDVGAEGQNMELA
Ga0193962_1172039Ga0193962_11720391F036294MDRGSAEEAVVGVKSVADDDTVTYLRVKLPKSDRDVGAEGRNM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.