NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300019760

3300019760: Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_4_MG



Overview

Basic Information
IMG/M Taxon OID3300019760 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129088 | Gp0217619 | Ga0193953
Sample NameMicrobial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_4_MG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size301646220
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Sediments And Microbial Mats In Various Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomerivermicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1644Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088705Metagenome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0193953_1121839Not Available614Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0193953_1121839Ga0193953_11218391F088705IMSVEKLEDYKDAFCIIKSEEFVVVSTNIDPLELYFVLDQLKMSLLTGGEYEL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.