NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300018573

3300018573: Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_2



Overview

Basic Information
IMG/M Taxon OID3300018573 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129121 | Gp0217192 | Ga0193572
Sample NameMetatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_2
Sequencing StatusPermanent Draft
Sequencing CenterWoods Hole Oceanographic Institution
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size29899903
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine benthic biomemarine benthic featurehypersaline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEastern Mediterranean Sea
CoordinatesLat. (o)34.4Long. (o)22.08Alt. (m)N/ADepth (m)3259
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000155Metagenome / Metatranscriptome1877Y
F000481Metagenome / Metatranscriptome1089Y
F020197Metagenome / Metatranscriptome225Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0193572_104336All Organisms → Viruses → Predicted Viral1077Open in IMG/M
Ga0193572_115668All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis514Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0193572_104336Ga0193572_1043363F020197MEYNKPFSKGFVLRTTAKHMRKSIDISIRKTFERMEEFADTEKSTEVLTTLSVLHIMRKWLDDF
Ga0193572_115668Ga0193572_1156681F000481RAKDQRKDEFDKLENIIKKHEELIPTVMKTQVMVDLYWKCYAYGDELKPHIEFLDGIMLSSTRDIAPSCVESVDELIERQEKSLVQLETKRGVVKELIEKGKIILQNPDKPKFLESHVKRIEDGWDDTKDKASARLKLLTETKDAWVGYAENSETIAVEFDKGEEEIKKVK
Ga0193572_116002Ga0193572_1160021F000155MKFALALAVVSATKYDHMNEDELLVNLSSTLSSALESEARGDGDAAVAKTAAIKNIQKSLTARILKRLDDGQPLVEVARKMKAIEGMQP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.