NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300018550

3300018550: Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0



Overview

Basic Information
IMG/M Taxon OID3300018550 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129055 | Gp0214161 | Ga0188833
Sample NameMetatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size4543866
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1
Not Available1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptome Of Marine Microbial Communities From Baltic Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBaltic Sea
CoordinatesLat. (o)62.09708Long. (o)18.5427Alt. (m)N/ADepth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004793Metagenome / Metatranscriptome423Y
F007749Metagenome / Metatranscriptome345Y
F022113Metagenome / Metatranscriptome216Y
F027191Metagenome / Metatranscriptome195Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0188833_100455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes995Open in IMG/M
Ga0188833_100461Not Available991Open in IMG/M
Ga0188833_100865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae709Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0188833_100446Ga0188833_1004462F022113IVIRLTIGRHRGAKRMIREAQKNSDEMSEDVYWDRLDSANHLADECKARIQQIFNDTFGG
Ga0188833_100455Ga0188833_1004551F007749VSAAEVMTYLGITIANPSDDYTLLTQSVSAGNQFCYRRRQESGYTDSLTTSPGGDATLGTLMYCAALWRSRGSIENTYATFDGMGTATQQSLTPIVKQLLAIPRPQVA
Ga0188833_100461Ga0188833_1004612F004793MNLIEAKKIVGNQPTWALKNMVKALKMLPLLNTAEDLERLTAAKLVIKERNKK
Ga0188833_100865Ga0188833_1008651F027191ERKKNEREKPLLQSINLVKVVRFLISPKKKRTKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQASNALSGCEKEEIPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.