NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300018512

3300018512: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002931 (ERX1782344-ERR1712163)



Overview

Basic Information
IMG/M Taxon OID3300018512 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117946 | Gp0217147 | Ga0193492
Sample NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002931 (ERX1782344-ERR1712163)
Sequencing StatusPermanent Draft
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10464687
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
All Organisms → cellular organisms → Eukaryota → Opisthokonta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean: TARA_137
CoordinatesLat. (o)14.2004Long. (o)-116.6398Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022575Metatranscriptome213Y
F047103Metagenome / Metatranscriptome150Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0193492_102055All Organisms → cellular organisms → Eukaryota683Open in IMG/M
Ga0193492_102700All Organisms → cellular organisms → Eukaryota600Open in IMG/M
Ga0193492_102818All Organisms → cellular organisms → Eukaryota → Opisthokonta588Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0193492_102055Ga0193492_1020552F047103MTKYAYFGPNLAVFGPKILSFMGVSKSFGTNITENHKDNLFASFFGQALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193492_102700Ga0193492_1027002F047103KMTKNADFGPNLAVFGPKSLIFMGLSKSFGTNITENHFGNLSALFFGQALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193492_102818Ga0193492_1028181F022575MQATATSNINNKYNLINKIDKLIIFKLGAXDPNNVNNKCPATIFAANRIDNVNGRMIFLTDSIITIIGIKKLGVPIGTKXQKRLLYXNIIDKIILPNHKGKANVKVNDIXLVLVKIYGKSPIKLEKII
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.