NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300018496

3300018496: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002193 (ERX1782219-ERR1712143)



Overview

Basic Information
IMG/M Taxon OID3300018496 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117946 | Gp0217138 | Ga0193477
Sample NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002193 (ERX1782219-ERR1712143)
Sequencing StatusPermanent Draft
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size5412536
Sequencing Scaffolds10
Novel Protein Genes10
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota9
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean: TARA_135
CoordinatesLat. (o)33.02Long. (o)-121.7406Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047103Metagenome / Metatranscriptome150Y
F059045Metagenome / Metatranscriptome134Y
F075646Metagenome / Metatranscriptome118Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0193477_100297All Organisms → cellular organisms → Eukaryota1002Open in IMG/M
Ga0193477_101286All Organisms → cellular organisms → Eukaryota546Open in IMG/M
Ga0193477_101287All Organisms → cellular organisms → Eukaryota546Open in IMG/M
Ga0193477_101288All Organisms → cellular organisms → Eukaryota546Open in IMG/M
Ga0193477_101289All Organisms → cellular organisms → Eukaryota546Open in IMG/M
Ga0193477_101290All Organisms → cellular organisms → Eukaryota546Open in IMG/M
Ga0193477_101291All Organisms → cellular organisms → Eukaryota546Open in IMG/M
Ga0193477_101292All Organisms → cellular organisms → Eukaryota546Open in IMG/M
Ga0193477_101343All Organisms → cellular organisms → Eukaryota539Open in IMG/M
Ga0193477_101552All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda509Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0193477_100297Ga0193477_1002972F075646MTFSPLIIWAKAPFFFEQLFPVVARTWLGLKSECLFFGPKFWFLAQKSDFCHTTPIFVDDPFLALGMTVNFPPWKRFFDFPFRSYSCFRKKIRLTAQKVFPPPTCGSSVCQ
Ga0193477_101286Ga0193477_1012861F047103MTKNADFGPNLAVFGPKILIFMGVSKSFGTNITENHLDNLSALFFGQALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193477_101287Ga0193477_1012872F047103LVGHWTKCAKNGNIWPKMTKNADFGPNLAVFGPKSLIFMGLSKSFGTNITENHFGNLSALFFGQALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193477_101288Ga0193477_1012882F047103LVGHWTKCAKNGNIWPKMTKNADFGPNLAVFGPKILIFMGVSKSFGTNITENHFGNLSALFFGHALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193477_101289Ga0193477_1012892F047103LVGHWTKCAKNGNIWPKMTKNADFGPNLAIFGPKSLIFMGLSKSFGTNITENHFGNLSALFFGQALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193477_101290Ga0193477_1012902F047103LVGHWTKCAKNGNIWPKMTKNADFGPNLAVFGPKSLIFMGVSKSFGTNITENHFGNLSALFFGHALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193477_101291Ga0193477_1012911F047103MTKNADFGPILAVFGPNILIFRGVSKSFGTNITENYLDNLSALFFGQTLDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193477_101292Ga0193477_1012922F047103LVGHWTKCAKNGNIWPKMTKNADFGPNLAVFGPKSLIFMGVSKSFGTNITGNHIHNLSALFFGQALDKMGQKCRYLAQNASFWPNLAVFGPKIQFFGGRE
Ga0193477_101343Ga0193477_1013432F047103MTKNEDFGPNLAIFGPKSLIFMGLSKSFGTNITENHFGNLSALFFGQALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE
Ga0193477_101552Ga0193477_1015521F059045LDNILCNLGDEIPKEDVQKMFAEICDPEDEDGLFPYMSFLDRLTGKA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.