x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017819
3300017819: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in ATCC 1651 MA medium w/o phosphatidylcholine, 4 C, 30 psu salinity and 140 ?mol photons light - Anophryoides haemophila AH6 (MMETSP1019) (SRX566756-SRR1328076)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300017819 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212296 | Ga0187713 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in ATCC 1651 MA medium w/o phosphatidylcholine, 4 C, 30 psu salinity and 140 ?mol photons light - Anophryoides haemophila AH6 (MMETSP1019) (SRX566756-SRR1328076) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 7843519 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | Atlantic Ocean |
| Coordinates | Lat. (o) | 43.51667 | Long. (o) | -65.6 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0187713_103312 | Ga0187713_1033121 | F077438 | SEDFSVTSLGCVYATHRVQPSFRQSRFETLFLWNLQVEISSALRPKAEKEISSYKN |
