NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017649

3300017649: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C BE-Lig OP (version 2)



Overview

Basic Information
IMG/M Taxon OID3300017649 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127392 | Gp0191739 | Ga0182741
Sample NameEnriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C BE-Lig OP (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size511004168
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia1
All Organisms → cellular organisms → Bacteria → Proteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → anthropogenic environment → compost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007999Metagenome341Y
F011188Metagenome / Metatranscriptome294Y
F036417Metagenome / Metatranscriptome170Y
F056036Metagenome138Y
F081015Metagenome / Metatranscriptome114Y
F098955Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0182741_1000391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi67349Open in IMG/M
Ga0182741_1000656All Organisms → cellular organisms → Bacteria49707Open in IMG/M
Ga0182741_1002645All Organisms → cellular organisms → Bacteria20426Open in IMG/M
Ga0182741_1040782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia1936Open in IMG/M
Ga0182741_1139314All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
Ga0182741_1185571All Organisms → cellular organisms → Bacteria529Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0182741_1000391Ga0182741_10003917F011188VDTYNIYMDEMPTGEEYDGEEMVEVEFRVVPGSDDDGDPETNAVIAGLDLVDLINLRDALQQEIDDYALAALESEALRLAEAE
Ga0182741_1000656Ga0182741_100065638F007999MHDNLPMTPWQRGEKARENLVNALRECGELADAVAAFQGPELLEVLDYLDSLRFVMAESGQILQGVVRGQQ
Ga0182741_1002645Ga0182741_10026453F036417MVYYARTPLRRLIPTVLVRLATDEGEVTFRARWRHTPIELQRMIMFRLRRGHPLWFEDDRGRDLCFKPEAVWAAVVDGR
Ga0182741_1040782Ga0182741_10407822F081015MTTIHADELQVGDVVEHLGARHLVRHVDRRAGWAWPVAFDDAGWAMALGHDLVVEVARPDDA
Ga0182741_1139314Ga0182741_11393141F056036VSARLKRELGAGVAVALLALGGAYWQAERTNAFEADTRTGETLRLV
Ga0182741_1185571Ga0182741_11855712F098955EQEVELDVALLINGLPNMLASTAFPLDDSWERIQAALDSGDARLAVAGMPYETTSASGRAETFPSAYVGMECANGERLVLAHIKGVDAEQQAEAYAREVINAILDGNSPVDLGETIED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.