NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017603

3300017603: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o silicate, 20 C, 29 psu salinity and 692 ?mol photons light - Chaetoceros curvisetus (MMETSP0717) (SRX549071-SRR1294457)



Overview

Basic Information
IMG/M Taxon OID3300017603 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212039 | Ga0187680
Sample NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o silicate, 20 C, 29 psu salinity and 692 ?mol photons light - Chaetoceros curvisetus (MMETSP0717) (SRX549071-SRR1294457)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7731945
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodymesotrophic water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)32.9Long. (o)-117.255Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051162Metagenome / Metatranscriptome144Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0187680_104703All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta650Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0187680_104703Ga0187680_1047032F051162IEMPLVKLFARKALSKPINLASIQSKLCTIWGTKPNTTKLILTKVDDWTDESFQEDVYVDIRAYGKPERTREMVLDGMEKVQGAFKDEGLIANVRLETYEGERYFHVPPKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.