NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017363

3300017363: Metatranscriptome of marine eukaryotic communities from unknown location in f/4 medium with seawater, at 20 C, 34 psu salinity and 246 ?mol photons light - Goniomonas pacifica CCMP 1869 (MMETSP0108)



Overview

Basic Information
IMG/M Taxon OID3300017363 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211851 | Ga0186139
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in f/4 medium with seawater, at 20 C, 34 psu salinity and 246 ?mol photons light - Goniomonas pacifica CCMP 1869 (MMETSP0108)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size48718849
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Cryptophyceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086665Metagenome / Metatranscriptome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186139_118336All Organisms → cellular organisms → Eukaryota → Cryptophyceae921Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186139_118336Ga0186139_1183361F086665VENRKNEPFICRLIKRHHFSTAIHEFFSLRDEPLRAVLWTQYYHVVVFPTFVSYPDISKIGKTDIRAYVAAGNNVVFLGGYLTLQVMNDIFGFSLRDDFKEGPYYRNDRNVRDTPFQFLPSRINEPSPRVFGAMSRSLPPGGRSLYDSLGNSVVFYISYDLGTVVYVGFQYDTPFNIERWVKVLHGAMGM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.