Sample 3300017319

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300017319

3300017319: Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in f/2 medium with seawater, 0.4uM P, 14 C, 36 psu salinity and 546 ?mol photons light - Ditylum brightwellii GSO104 (MMETSP1012)

Overview

Basic Information
IMG/M Taxon OID	3300017319 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0128947 \| Gp0212379 \| Ga0186667
Sample Name	Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in f/2 medium with seawater, 0.4uM P, 14 C, 36 psu salinity and 546 ?mol photons light - Ditylum brightwellii GSO104 (MMETSP1012)
Sequencing Status	Permanent Draft
Sequencing Center	National Center for Genome Resources
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	42620984
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gymnodiniales → Gymnodiniaceae → Akashiwo → Akashiwo sanguinea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → coastal water body → coastal sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Pacific Ocean
Coordinates	Lat. (^o)	41.325	Long. (^o)	-70.57	Alt. (m)	N/A	Depth (m)	.5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008117	Metagenome / Metatranscriptome	338	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0186667_122827	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gymnodiniales → Gymnodiniaceae → Akashiwo → Akashiwo sanguinea	546	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186667_122827	Ga0186667_1228271	F008117	LASKPATGVSQDALWKAMLYSMRNPAESGLKVDSVSVRDTKGYMQRSMRLLEKTGSPTVIDNIRVIESAQEITYRPVINSVEAEEERVFALRTEPLRLEMFCRHSRDEMRLDWQAPRSICVGVFDATLAAAQRL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.