NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017289

3300017289: Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in K medium with artificial sea water, no silicate, 21 C, 35 psu salinity and 466 ?mol photons light - Isochrysis sp. CCMP1244 (MMETSP1388)



Overview

Basic Information
IMG/M Taxon OID3300017289 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212083 | Ga0186371
Sample NameMetatranscriptome of marine eukaryotic communities from North Atlantic Ocean in K medium with artificial sea water, no silicate, 21 C, 35 psu salinity and 466 ?mol photons light - Isochrysis sp. CCMP1244 (MMETSP1388)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size38201435
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1
All Organisms → cellular organisms → Eukaryota1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Atlantic Ocean
CoordinatesLat. (o)38.3048Long. (o)-69.6192Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008013Metagenome / Metatranscriptome340Y
F009840Metagenome / Metatranscriptome312Y
F088199Metatranscriptome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186371_117895All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi822Open in IMG/M
Ga0186371_119672All Organisms → cellular organisms → Eukaryota758Open in IMG/M
Ga0186371_124238Not Available606Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186371_117895Ga0186371_1178951F008013SRMSATQSARPSVQPDLTPSALSEPPESLLGAVQQAIFVEPYPNCKACGEVAGYISPFEVSPGCYKILAEDDDWITGVLTMAVGEKDLLHHHKDHLIYVLEGDGVTIYPGGDESAAMVVPLQVGAGIPAPMSAPPFAKHTLLNSGTVPLKMVFFEAKK
Ga0186371_119672Ga0186371_1196721F009840LRSASMRALSWLLLCSFRGTSALQPSRPGVSRRPLLQHALALGVLAPGAAAAAAEKKPSLKEVVAQLDAGTPKEERNAHGEKADHFPQIAFEGGQGQGKKVVFTVPHQNLSPPSFSYIEYMWIKDEESGAILTARKFRPSDPDLVITAFGSSGQRLTAASKDDKFGIWQGTFRVP
Ga0186371_124238Ga0186371_1242381F088199GRSVHARNMVRCSCLVLALVVGAVSALVVAPPAAVSSSARVAAGPVMACNGGKGGNGGKNPPKDKTVYRPKLSKLIQRADSAENVKSVLLTAQTEAMLLKMNWKYRRAAAHQVRKRAAQFGVEVPGNFAAFNVRPRNAKKHLLVPSM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.