NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017270

3300017270: Metatranscriptome of marine eukaryotic communities from Northern Baffin Bay in L1 medium with seawater and antibiotics, 6 C, 36 psu salinity and 395 ?mol photons light - unclassified eukaryote CCMP 2098 (MMETSP0993)



Overview

Basic Information
IMG/M Taxon OID3300017270 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212052 | Ga0186340
Sample NameMetatranscriptome of marine eukaryotic communities from Northern Baffin Bay in L1 medium with seawater and antibiotics, 6 C, 36 psu salinity and 395 ?mol photons light - unclassified eukaryote CCMP 2098 (MMETSP0993)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size60837953
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorthern Baffin Bay
CoordinatesLat. (o)76.285Long. (o)-73.0575Alt. (m)N/ADepth (m)75
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051149Metagenome / Metatranscriptome144Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186340_113664All Organisms → cellular organisms → Eukaryota1346Open in IMG/M
Ga0186340_114775All Organisms → cellular organisms → Eukaryota1285Open in IMG/M
Ga0186340_115074All Organisms → cellular organisms → Eukaryota1272Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186340_113664Ga0186340_1136641F051149MGAAASAPGAFERLPETVDEPTAMALLGNCFDRADWETITGGTGKCPKDTFTTTISVRNHAVSLRAWLEFWRLDELLDTLESLDVMSPTDLMLLEEKEVSKIDLKVVQQKHWAKALAHSKYLQAIDFDKPPSPLYLWLESWRLERIAPGLFNLGCDVKEDIIDVSEQDSASLGLKLLEERRWKQATSQLVKVIRNYDFNDNTRNSAPSLTTWLASLKLEELDEPLTMLGVVELCDLGDMDDRELHSLNLNKLQRKHWDMGMLQVLKARKEAGLDSKNDDPTFRGFLESWRLGRLGPVMQELGAYVQQDLLDLEPTEYSLLKMRPLEAKRFEQAMIALEEEFQQWS
Ga0186340_114775Ga0186340_1147751F051149MALLGHCFDRADWETITGGTGKVPKDTFITTITVRNHAPSLRAWLEFWRIDELLEILESLDVMSPTDLMLLEEKDISKIHLKAVQKKHWQKAVAHSKYLEAIHFDKPPSPLHLWLESWRLDRLKSGLYELGCDVKEDIIDLTESDAALLGMRLLEERRWKQACSQLVKVIRNYDFNDNTRNSAPSLTTWLASLKLEELDEPLTMLGVVELCDLGDMDDRELHSLNLNKLQRKHWDMGMLQVLKARKEAGLDSKNDDPTFRGFLESWRLGRLGPVMQELGAYVQQDLLDLEPTEYSLLKMRPLEAKRFEQAMIALEEEFQQWS
Ga0186340_115074Ga0186340_1150741F051149MGAGASAPGAFDRLPDPVDEATALALLGNCFDRADWETITAGTGKCIRSTFITTIEVRNHALSLRSWLEFWRIDELLEVLESLDVMSPTDLTLLEEKEVSKIGLKAVQKKHWQKALAHSKYLEAIHFDKPPSPLNLWLESWRLDRLGEGLFNLGCDVKEDIIDLMESDAAALGMKLLEERRWKQATAQLLTVIRHYDFNDNTRNSAPSLVTWLASLKLQELDEPLKLLGVVELCDLGDMDDRELASLGLNKLQRKHWDMGMLQVLKAKSEARLDGKNDDPTFRAFLESWRLGRLGPVMGDLGAYVQQDLLDLEPNEYSLLKMRPLEAKRFEQAMIALEEEFQQWT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.