NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017244

3300017244: Metatranscriptome of marine eukaryotic communities from Northern Baffin Bay in L1 medium with seawater and antibiotics, 6 C, 36 psu salinity and 380 ?mol photons light - unclassified eukaryote CCMP 2098 (MMETSP0992)



Overview

Basic Information
IMG/M Taxon OID3300017244 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212054 | Ga0186342
Sample NameMetatranscriptome of marine eukaryotic communities from Northern Baffin Bay in L1 medium with seawater and antibiotics, 6 C, 36 psu salinity and 380 ?mol photons light - unclassified eukaryote CCMP 2098 (MMETSP0992)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size43275450
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorthern Baffin Bay
CoordinatesLat. (o)76.285Long. (o)-73.0575Alt. (m)N/ADepth (m)75
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021038Metagenome / Metatranscriptome220Y
F051149Metagenome / Metatranscriptome144Y
F073111Metagenome / Metatranscriptome120Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186342_105686All Organisms → cellular organisms → Eukaryota1660Open in IMG/M
Ga0186342_108469All Organisms → cellular organisms → Eukaryota1378Open in IMG/M
Ga0186342_114139All Organisms → cellular organisms → Eukaryota1013Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186342_105686Ga0186342_1056861F073111MSPTDLTLLEEKEVSKIGLKAVQKKHWQKALAHSKYLEAIHFDKPPSPLNLWLESWRLDRLGEGLFNLGCDVKEDIIDLMESDAAALGMKLLEERRWKQATAQLLTVIRHYDFNDNTRNSAPSLVTWLASLKLQELDEPLKLLGVVELCDLGDMDDRELASLGLNKLQRKHWDMGMLQVLKAKSEARLDGKNDDPTFRAFLESWRLGRLGPVMGDLGAYVQQDLLDLEPNEYSLLKMRPLEAKRFEQAMIALEEEFQQWT
Ga0186342_108469Ga0186342_1084691F051149MGANASSPGAFERLPDPVDEPTAMAILGKCFDRADWETITGGTGSVQKDTFITTITVRNHAPSLRAWLEFWRIDELLEVLESLDVMTPTDLMLLEEKEVLKIELKAVQKKHWQKAVTHSKYLEAINFDKPPSPLHLWLESWRLHRLKKGLFDLGCDVKEDIIDLDDTNAALLGMKLLEERRWKQATAQLVKVIRNFNFNDNTRNSAPSLITWLESLKLEELDEPLKLLGVVELCDLGDMDDRELHSLGLNKLQRKHWDMGMLQVLKAKGEAGLDGKNDDPTFRGFLESWRLGRLAPVMDDLGAYVQQDLLDLEPSEYSLLKMRPLEAKRFEQAMIALEEEFQQWA
Ga0186342_114139Ga0186342_1141391F021038MKVLSAPADKPKIVFHVAMMSLQNFGFFIMYYSLWIATPDAEICADTRFAEGFMALTCFLVAFLCVGMGFGGYTDDAAVFAVYWIAHAVPAVGGYTTCTFLIPMARFSDSGMACASLSPVIGTIVQSVYVVHAGLYWCYVGNMVSVTYFSFLKPSFDFTVKPVVALSALALAEALVFGKLVDIGAFEPLSLPSPKTKLFGLFFMW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.