NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017232

3300017232: Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in modified f/2 medium with seawater, 3 C, 33.6 psu salinity and 448 ?mol photons light - Proboscia alata PI-D3 (MMETSP0174)



Overview

Basic Information
IMG/M Taxon OID3300017232 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0212312 | Ga0186600
Sample NameMetatranscriptome of marine eukaryotic communities from Antarctic Ocean in modified f/2 medium with seawater, 3 C, 33.6 psu salinity and 448 ?mol photons light - Proboscia alata PI-D3 (MMETSP0174)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size49052068
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouthern Ocean
CoordinatesLat. (o)-64.0038Long. (o)-0.0025Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015298Metagenome / Metatranscriptome255Y
F078213Metagenome / Metatranscriptome116Y
F098600Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186600_119682All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta887Open in IMG/M
Ga0186600_121130All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis821Open in IMG/M
Ga0186600_129233All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta514Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186600_119682Ga0186600_1196821F098600KNTKVVNLKFSLADCVMVNKLFALAWTSVYFCRIVLITNGIIYAISGIAYFGESYDGFELRENTDFTQYSFPVLASVIKDAVIKDQFDGLLILAPFMGAAYICVAFTSLAAAFLFRNPEAAMTLLLQAALLSMLGCIVRPQEPDDFYNEGQKDVVQNSQLVAVITGWIGAFGPIIAVLLKQEVPTPIEYTMSYLSYAFSKDETTETVKECSA
Ga0186600_121130Ga0186600_1211301F015298VLIRTTNRTIAKRTRHYSMNGILKYLIAHKDWLLLVCFSVDAINTLITFPLIMWNGPKWLLKSADPDAKEKIEDASKANTTVDLSDTERKSFEVLWEIFGVCYEGYTGFTISTLICLFRIPETRPIFAYSLFALYLYKAKSFLTFKTDNPQGKGKLMTILFFYWPCYGGYCLLHLIEHYL
Ga0186600_129233Ga0186600_1292331F078213KELNIDPSICFADDGGSAGDILGLSKGFGTMWNPPAVDMMMSRNDKESLTMLGNAYKNAADEIGIQKLAPKDVADTLRQGGTFAFRGKTAILEHYDSKVGNNCEINAILSSLSSSS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.