NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017227

3300017227: Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in f/2 medium, 20 C, 21 psu salinity and 751 ?mol photons light - Striatella unipunctata CCMP 2910 (MMETSP0800)



Overview

Basic Information
IMG/M Taxon OID3300017227 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212107 | Ga0186395
Sample NameMetatranscriptome of marine eukaryotic communities from Mediterranean Sea in f/2 medium, 20 C, 21 psu salinity and 751 ?mol photons light - Striatella unipunctata CCMP 2910 (MMETSP0800)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25696576
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationMediterranean Sea
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089930Metagenome / Metatranscriptome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186395_100007All Organisms → cellular organisms → Eukaryota6948Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186395_100007Ga0186395_1000072F089930LSLHEILEVKAGCVGYDHTTLPAAGNSKTSKKGRNENKHSSLFLTLKAAPTPMAAARSYIMRFKSRSARNDLLKGLRGMLSDMQIKEGVSISSVQNSGQRTNGFGPGHEEDDDEIMIPLPDVHKAIDRERENYDRLLLLMLQGSDDLKEKEDEILGLRGKLETVTAESLEKDRVQANDSKLIMQLSKKLETLLMDNEDLRDQNDRLNSRLVAVECEKMNLMN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.