NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017225

3300017225: Metatranscriptome of marine eukaryotic communities from Sea of Japan in seawater with wheat grains, 20 C, 35 psu salinity and 681 ?mol photons light - Paramoeba aestuarina SoJaBio B1-5/56/2 (MMETSP0161_2)



Overview

Basic Information
IMG/M Taxon OID3300017225 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211946 | Ga0186234
Sample NameMetatranscriptome of marine eukaryotic communities from Sea of Japan in seawater with wheat grains, 20 C, 35 psu salinity and 681 ?mol photons light - Paramoeba aestuarina SoJaBio B1-5/56/2 (MMETSP0161_2)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25331023
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)oceanic abyssopelagic zone biomesea floordeep marine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSea of Japan
CoordinatesLat. (o)42.26722Long. (o)136.71861Alt. (m)N/ADepth (m)3665
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040999Metagenome / Metatranscriptome160Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186234_113839Not Available724Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186234_113839Ga0186234_1138392F040999MAKPSVRILEHRVKFFDNRPDEVNDCRNDDTYKKWLKGKTAAATVVQGTSQQESITFKVEGADVKGLTRTNKTSKFYVPVNTESVKLGDFAVGEHTHTFDKQEIENIAAARANWSLTTTFHDESGNEFCKRESSFKIVGPQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.