NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017213

3300017213: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in GSe medium with ammonium, 15 C, 32 psu salinity and 351 ?mol photons light - Pelagococcus subviridis CCMP 1429 (MMETSP0885)



Overview

Basic Information
IMG/M Taxon OID3300017213 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212011 | Ga0186299
Sample NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in GSe medium with ammonium, 15 C, 32 psu salinity and 351 ?mol photons light - Pelagococcus subviridis CCMP 1429 (MMETSP0885)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26741787
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)49.9166Long. (o)-145.1166Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026197Metagenome / Metatranscriptome198Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186299_100431All Organisms → cellular organisms → Eukaryota3544Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186299_100431Ga0186299_1004313F026197VVKAILFGERVDQRAATSLVCAPQEEAPEEKRRQPRSAEHTMKAAALVALCLQRAVALPRLADEKMLCERGRCDAHGLKYERVMPSQPGYQWDDAGGYCGSWATQRAALTVGAWISQQQVRDHASDCGGHDSEILSCNIEEALTGLKLEFNAWDYKNESTPQTDAYAAWLKAQLAGGHAVAWMIMWSGQDYPIYDLTPPDGMYGHVEPVIGVASNHPLNDTTVYDDDVVLHYTDGGVNTVQRGLTTLAGEWAGPGEKADCGDYQYCVGNPYGFGWAIKGYAARDGAVAASLRVAPFLSEPDTRSGEAPESLRGTVTATGLTPGAAYDVYRWDDVENVGTFDDAHKSATFTASKDAHVYVDDKSIPSDGTTYYKVVLASA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.