NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017189

3300017189: Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in F/2 medium with seawater, 0.4uM PO4, 20 C, 35 psu salinity and 383 ?mol photons light - Thalassiosira rotula GSO102 (MMETSP0910)



Overview

Basic Information
IMG/M Taxon OID3300017189 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212378 | Ga0186666
Sample NameMetatranscriptome of coastal eukaryotic communities from Pacific Ocean in F/2 medium with seawater, 0.4uM PO4, 20 C, 35 psu salinity and 383 ?mol photons light - Thalassiosira rotula GSO102 (MMETSP0910)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26040402
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodycoastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)48.629353Long. (o)-122.957542Alt. (m)N/ADepth (m).5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067805Metagenome / Metatranscriptome125Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186666_114165All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi605Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186666_114165Ga0186666_1141651F067805MGRKQQPKEEELTLSKKEQKKVDKLTAQIPYHQGRGNMEEVTKIKEQIDSIWEKAKEAQF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.